Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

WH0001268M1

Sigma-Aldrich

Monoclonal Anti-CNR1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-CANN6, Anti-CB1, Anti-CB1A, Anti-CB1K5, Anti-CBR, Anti-CNR, Anti-cannabinoid receptor 1 (brain)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

2F9, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2bκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CNR1(1268)

Descripción general

Cannabinoid receptor 1 (CNR1) also known as the type-1 cannabinoid receptor (CB1), is encoded by the gene mapped to human chromosome 6q15. The encoded protein is a member of the class A G protein-coupled receptor (GPCR) family and is highly expressed in the brain and the central nervous system.
This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. (provided by RefSeq)

Inmunógeno

CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV

Acciones bioquímicas o fisiológicas

Cannabinoid receptor 1 (CNR1) plays a key role in regulation of the endocannabinoid system (ECS), which is involved in most of the activities of the brain and body. Mutations in the gene has been associated with the development of hebephrenic schizophrenia. Experimental studies hypothesize that aberrations in CNR1 gene increases the risk of susceptibility to substance abuse.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Cannabinoid receptor gene (CNR1): association with i.v. drug use.
Comings DE
Molecular Psychiatry, 2, 161-168 (1997)
The CB1 Receptor as the Cornerstone of Exostasis.
Piazza PV
Neuron, 93, 1252-1274 (2017)
The incentive salience of alcohol: translating the effects of genetic variant in CNR1.
Hutchison KE
Archives of General Psychiatry, 65, 841-850 (2008)
CNR1, central cannabinoid receptor gene, associated with susceptibility to hebephrenic schizophrenia.
Ujike H
Molecular Psychiatry, 7, 515-518 (2002)
Crystal Structure of the Human Cannabinoid Receptor CB1.
Hua T
Cell, 167, 750-762 (2016)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico