Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

374090

Sigma-Aldrich

Anti-Heme Oxygenase-1 (1-30) Rabbit pAb

liquid, Calbiochem®

Sinónimos:

Anti-HO-1, Anti-Hsp32

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

antibody form

purified antibody

antibody product type

primary antibodies

clone

polyclonal

form

liquid

contains

≤0.1% sodium azide as preservative

species reactivity

human, hamster, monkey, mouse, rat, canine

manufacturer/tradename

Calbiochem®

storage condition

OK to freeze
avoid repeated freeze/thaw cycles

isotype

IgG

shipped in

ambient

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HMOX1(3162)

General description

Anti-Heme Oxygenase-1 (1-30), rabbit polyclonal, recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. It is validated for use in Western blotting and immunoprecipitation.
Protein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.
Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.

Immunogen

Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Application

Immunoblotting (1:1000, chemiluminescence)

Immunoprecipitation (1:100)

Warning

Toxicity: Standard Handling (A)

Physical form

In PBS, 50% glycerol, pH 7.2.

Reconstitution

Following initial thaw, aliquot and freeze (-20°C).

Other Notes

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Maines, M.D. 1988 FASEB J.2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Jin-Woo Jeong et al.
Foods (Basel, Switzerland), 8(8) (2019-07-31)
Sea tangle (Laminaria japonica Aresch), a brown alga, has been used for many years as a functional food ingredient in the Asia-Pacific region. In the present study, we investigated the effects of fermented sea tangle extract (FST) on receptor activator
Da Hye Kwon et al.
International journal of molecular medicine, 41(1), 264-274 (2017-11-09)
Schisandrin A is a bioactive lignan occurring in the fruits of plants of the Schisandra genus that have traditionally been used in Korea for treating various inflammatory diseases. Although the anti-inflammatory and antioxidant effects of lignan analogues similar to schisandrin A have
Dong-Sung Lee et al.
Molecular medicine reports, 15(1), 451-459 (2016-12-14)
Liver diseases are considered to be primary contributors to morbidity and mortality rates in humans. Oxidative stress is critical in liver injury, and oxidant‑induced liver injury may be caused by toxins, including tert‑butyl hydroperoxide (t‑BHP). The present study investigated the
Seon Yeong Ji et al.
Biomolecules & therapeutics, 29(6), 685-696 (2021-04-07)
In this study, we investigated the inhibitory effect of 5-aminolevulinic acid (ALA), a heme precursor, on inflammatory and oxidative stress activated by lipopolysaccharide (LPS) in RAW 264.7 macrophages by estimating nitric oxide (NO), prostaglandin E2 (PGE2), cytokines, and reactive oxygen
Chia-Wen Lo et al.
Environmental toxicology, 39(8), 4120-4133 (2024-04-24)
Lipotoxicity leads to numerous metabolic disorders such as nonalcoholic steatohepatitis. Luteolin, apigenin, and chrysin are three flavones with known antioxidant and anti-inflammatory properties, but whether they inhibit lipotoxicity-mediated NLRP3 inflammasome activation was unclear. To address this question, we used J774A.1

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico