SAB1412035

ANTI-FOXC2 antibody produced in mouse

clone 3H3, ascites fluid

• Sinónimos: FKHL14, FOXC2, LD, MFH-1, MFH1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 3H3, monoclonal
• mol wt: antigen 34.65 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgMλ
• NCBI accession no.: NM_005251
• UniProt accession no.: Q99958
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FOXC2(2303)

Descripción

General description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. (provided by RefSeq)

Immunogen

FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY

Physical form

Clear solution

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable