Saltar al contenido
Merck

MSQC11

Sigma-Aldrich

SILuMAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody

Sinónimos:

Mass spectrometry standard, Adalimumab, SIL Adalimumab, Stable isotope labelled Adalimumab

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
41105501
NACRES:
NA.41

recombinante

expressed in CHO cells

Nivel de calidad

tipo de anticuerpo

primary antibodies

Ensayo

≥90% (SDS-PAGE)

envase

vial of 100 μg

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Descripción general

SILu MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody is a recombinant, stable isotope labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMAb Adalimumab is designed to be used as an internal standard for analysis of Adalimumab in human serum. Each vial of SILuMAb Adalimumab contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A280 and using an extinction coefficient (E0.1%) of 1.4.
SILu MAb Adalimumab is for R&D use only. Not for drug, household, or other uses.

Inmunógeno

SILuMab Adalimumab Heavy Chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGR
FTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMab Adalimumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Secuencia

Adalimumab-Specific Peptide Sequences Liberated from SILuMAb Adalimumab by Tryptic Digest

Universal Peptide Sequence Location
GLEWVSAITWNSGHIDYADSVEGRHeavy chain
APYTFGQGTKLight chain
FSGSGSGTDFTLTISSLQPEDVATYYCQRLight chain

Nota de preparación

Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled Arginine and 13C6, 15N2-labeled Lysine.
SILuMab Adalimumab is designed to be used as a internal standard for analysis of Adalimumab in human serum.

Reconstitución

Each vial of SILuMab Adalimumab contains the labeled antibody in a lyophilized form containing phosphate buffered saline.
SILuMab Adalimumab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.

  • Briefly centrifuge the vial at ~10,000 × g to collect the product at the bottom of the vial.
  • Add 500 μL of ultrapure water containing 0.1% formic acid to the vial.
  • Mix the contents by gently inverting the vial a minimum of 5 times.
  • Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.

Nota de análisis

Quantitative
MRM settings provided (xls)

Información legal

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

13 - Non Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Comparison of Target- and IgG-Enrichment Strategies to Measure Adalimumab Concentrations in Human Plasma Using an Immunocapture-Liquid Chromatography-High-Resolution Mass Spectrometry Platform.
Xiaoliang Ding et al.
Annals of laboratory medicine, 44(5), 463-466 (2024-04-09)

Artículos

Monoclonal antibodies Infliximab and Adalimumab target TNFα for treating rheumatoid arthritis and autoimmune diseases.

Monoclonal antibodies Infliximab and Adalimumab target TNFα for treating rheumatoid arthritis and autoimmune diseases.

Monoclonal antibodies Infliximab and Adalimumab target TNFα for treating rheumatoid arthritis and autoimmune diseases.

Monoclonal antibodies Infliximab and Adalimumab target TNFα for treating rheumatoid arthritis and autoimmune diseases.

Protocolos

An optimized LC-MS/MS based workflow for low artifact tryptic digestion and peptide mapping of monoclonal antibody, adalimumab (Humira) using filter assisted sample preparation (FASP).

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico