Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV47723

Sigma-Aldrich

Anti-TBX15 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-T-box 15, Anti-TBX14

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

55 kDa

reactividad de especies

rabbit, rat, human, bovine, horse, mouse, dog, guinea pig

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TBX15(6913)

Descripción general

TBX15 codes for T-box transcription factor that regulates embryonic development. TBX15 mutations have been linked to Cousin syndrome.
Rabbit anti-TBX15 antibody recognizes human, mouse, rat, and canine TBX15.

The previously assigned protein identifier Q5JT54 has been merged into Q96SF7. Full details can be found on the UniProt database.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human TBX15

Aplicación

Rabbit anti-TBX15 antibody is suitable for western blot applications at a concentration of 1.25μg/ml and for IHC applications (using paraffin-embedded tissues) at 4-8μg/ml.

Acciones bioquímicas o fisiológicas

TBX15 is a probable transcriptional regulator involved in developmental processes.

Secuencia

Synthetic peptide located within the following region: YGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMH

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Esra Dikoglu et al.
American journal of medical genetics. Part A, 161A(12), 3161-3165 (2013-09-17)
Cousin syndrome, also called pelviscapular dysplasia (OMIM 260660), is characterized by short stature, craniofacial dysmorphism, and multiple skeletal anomalies. Following its description in two sibs in 1982, no new cases have been observed until the observation of two unrelated cases
Ekkehart Lausch et al.
American journal of human genetics, 83(5), 649-655 (2008-12-11)
Members of the evolutionarily conserved T-box family of transcription factors are important players in developmental processes that include mesoderm formation and patterning and organogenesis both in vertebrates and invertebrates. The importance of T-box genes for human development is illustrated by

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico