Saltar al contenido
Merck
Todas las fotos(1)

Key Documents

AV46881

Sigma-Aldrich

Anti-LETM1 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Leucine zipper-EF-hand containing transmembrane protein 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

60 kDa

species reactivity

dog, mouse, horse, guinea pig, bovine, human, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... LETM1(3954)

Immunogen

Synthetic peptide directed towards the middle region of human LETM1

Application

Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

Biochem/physiol Actions

LETM1 (leucine zipper-EF-hand containing transmembrane protein 1) gene encodes a single-pass membrane protein localized in the inner mitochondrial membrane. It plays a pivotal role in maintaining the mitochondrial tubular shape as well as cristae organization. It also facilitates the normal mitochondrial morphology and cellular viability. Mutation in LETM1 gene leads to Wolf-Hirschhorn syndrome.

Sequence

Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Kai Stefan Dimmer et al.
Human molecular genetics, 17(2), 201-214 (2007-10-11)
Wolf-Hirschhorn syndrome (WHS) is a complex congenital syndrome caused by a monoallelic deletion of the short arm of chromosome 4. Seizures in WHS have been associated with deletion of LETM1 gene. LETM1 encodes for the human homologue of yeast Mdm38p
Xiaogang Zhang et al.
Cerebral cortex (New York, N.Y. : 1991), 24(10), 2533-2540 (2013-05-07)
Leucine zipper-EF-hand containing transmembrane protein 1 (Letm1) is a mitochondrial protein that is associated with seizure attacks in Wolf-Hirschhorn syndrome. This study aimed to investigate the expression pattern of Letm1 in patients with temporal lobe epilepsy (TLE) and pilocarpine-induced rat
Shoko Tamai et al.
Journal of cell science, 121(Pt 15), 2588-2600 (2008-07-17)
LETM1 is located in the chromosomal region that is deleted in patients suffering Wolf-Hirschhorn syndrome; it encodes a homolog of the yeast protein Mdm38 that is involved in mitochondrial morphology. Here, we describe the LETM1-mediated regulation of the mitochondrial volume

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico