AV38756

Anti-PEG3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Paternally expressed 3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• mol peso: 181 kDa
• reactividad de especies: dog, bovine, rabbit, human, horse, pig
• envase: pkg of 100 μL buffered aqueous solution; pkg of 50 μg lyophilized powder
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_006201
• Nº de acceso UniProt: Q9GZU2
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PEG3(5178)

Descripción

Descripción general

Paternally expressed 3 (PEG3, PW1) is involved in maternal genomic imprinting that is paternally expressed. Paternal expression of PEG3 regulates sexually experience effects on male behavior in mammals involving display of sexual behavior, aggression, and olfaction. PEGS reglulates sexual experience dependent preferences for estrous odors. PW1 identifies multiple adult stem and progenitor cell populations and serves as a marker for competent self-renewing stem cells in a wide array of adult tissues. Peg3/Pw1 is involved in the p53-mediated cell death pathway as a downstream effector of p53 in brain ischemia/hypoxia.

Especificidad

Anti-PEG3 polyclonal antibody reacts with bovine, canine, pig, human, mouse, rat paternally expressed 3 proteins.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human PEG3

Aplicación

Anti-PEG3 polyclonal antibody is used to tag paternally expressed 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of paternally expressed 3 in genomic imprinting of male sexual behaviour, as a marker for competent self-renewing stem cells and in p53-mediated cell death.

Acciones bioquímicas o fisiológicas

PEG3 induces apoptosis in cooperation with SIAH1A and acts as a mediator between TP53/p53 and BAX in a neuronal death pathway that is activated by DNA damage. PEG3 acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. PEG3 also possesses a tumor suppressing activity in glioma cells.

Secuencia

Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable