Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

L7880

Sigma-Aldrich

β-Lactoglobulin A from bovine milk

≥90% (PAGE)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Numéro CAS:
50863-92-8
Numéro MDL:
MFCD00130636
Code UNSPSC :
12352202
Nomenclature NACRES :
NA.61
Le tarif et la disponibilité ne sont pas disponibles actuellement.

Source biologique

bovine milk

Niveau de qualité

200

Essai

≥90% (PAGE)

Forme

powder

Poids mol.

18,363 Da by calculation

Technique(s)

HPLC: suitable

Numéro d'accès UniProt

P02754

Température de stockage

2-8°C

Informations sur le gène

bovine ... LGB(280838)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

A member of the lipocalin family, βLg is a small protein of 162 amino acids with a molecular mass of ∼18,400 Da, featuring an eight-stranded β-barrel (strands A-H) succeeded by a three-turn a-helix and a final β-strand (strand I) that forms part of the dimerization interface.[1]
Milk from dairy cows contains the protein β-lactoglobulin (BLG). It naturally occurs in a number of genetic variants, and the most prevalent bovine variants are known as BLG A and BLG B.[2]

Application

β-Lactoglobulin A from bovine milk has been used:
  • as a calibrant for the calibration of the TriWave device[3]
  • as a standard in the detection and quantification of β-lactoglobulin in bovine milk by reverse-phase high performance liquid chromatography (HPLC)[4]
  • in the purification and molecular weight measurement of protease samples[5]

β-Lactoglobulin was used in the identification of the genetic variants of κ-casein in milk by isoelectric focusing electrophoresis.[6]

Actions biochimiques/physiologiques

β-Lactoglobulin (β-lg) possesses heat-set gelation properties. It also exhibits antiviral, anticarcinogenic and hypocholesterolemic effects. β-lg can bind to retinol and long-chain fatty acids. It may participate in the absorption and metabolism of fatty acids.[7]

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, type N95 (US)

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
0000403266
0000377455
0000374056
0000326214
0000326244

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Bioactive milk proteins, peptides and lipids and other functional components derived from milk and bovine colostrum
Functional Foods, 471-511 (2011)
K M Oliveira et al.
European journal of biochemistry, 268(2), 477-483 (2001-02-13)
The crystal structures of beta-lactoglobulin genetic variants A and B have been determined in the orthorhombic space group C222(1) (lattice Y) by X-ray diffraction at 2.0 A and 1.95 A resolution, respectively. The structural comparison shows that both variants exhibit
Laurette Tavel et al.
Journal of agricultural and food chemistry, 56(21), 10208-10217 (2008-10-22)
Interactions between beta-lactoglobulin (BLG) in its monomeric form and a wide range of aroma compounds were investigated by Fourier transform infrared (FT-IR) and 2D nuclear magnetic resonance (NMR) spectroscopies. A screening of the ligands was carried out by FT-IR through
Jeremy Pronchik et al.
The journal of physical chemistry. B, 112(36), 11422-11434 (2008-08-19)
We use time-dependent fluorescence Stokes shift (TDFSS) information to study the fluctuation rates of the lipocalin, beta-lactoglobulin A in the vicinity of an encapsulated coumarin 153 molecule. The system has three unique dielectric environments in which the fluorophore binds. We
An Acid Protease Produced by Monilinia fructigena in vitro and in Infected Apple Fruits, and its Possible Role in Pathogenesis
Hislop EC, et al.
Microbiology, 128(4), 799-807 (1982)
Afficher tous les articles scientifiques apparentés

Questions

1–2 of 2 Questions  

  1. Do you have the amino acid sequence of Product L7880, β-Lactoglobulin A from bovine milk?

    1 answer

    1. Uniprot P02754 describes beta Lactoglobulin.The first 16 amino acids of that sequence are the signal peptide, so the sequence of beta-Lactoglobulin B corresponds to amino acids 17-178.But Product L7880 is beta-Lactoglobulin A. As shown in the details under the first link, this form of the protein varies by two amino acids from beta-Lactoglobulin B:1. Instead of the glycine (G) at position 80 of the B form, the A form has an aspartic acid (D).2. Instead of the alaline (A) at position 134 of the B form, the A form has a valine (V).So to answer your question, the sequence of Product L7880 is:LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

      Helpful?

  2. What is the Department of Transportation shipping information for this product?

    1 answer

    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      Helpful?

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique