Accéder au contenu
Merck
Toutes les photos(3)

Documents

I17001

Sigma-Aldrich

Interferon-γ human

IFN-gamma, recombinant, expressed in HEK 293 cells, suitable for cell culture, endotoxin tested

Synonyme(s) :

IFN-γ

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352202
Nomenclature NACRES :
NA.77

Produit recombinant

expressed in HEK 293 cells

Niveau de qualité

Pureté

≥98% (SDS-PAGE)

Forme

lyophilized powder

Puissance

≤0.250 ng/mL In Viral Resistance Assay ED50

Poids mol.

16 kDa (glycosylated)

Technique(s)

cell culture | mammalian: suitable

Adéquation

endotoxin tested

Température de stockage

−20°C

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

Interferon-γ (IFN-γ) is a pleotropic cytokine, encoded by the gene mapped to human chromosome 12q15. It is a non-covalent homodimer with two identical 17kDa polypeptide chains. It belongs to the type II class of interferons.
Recombinant human Interferon-γ (IFN-γ) is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 16 kDa. This protein is manufactured in human cells using an all-human production system, with full chemically defined ingredients and with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture. The bioactivity of IFN-γ expressed in human 293 cells is significantly higher compared to bacterially expressed IFN-γ.

Application

Interferon-γ human has been used in cytometric bead array to measure the levels of interferon-γ in the sample.
It has also been used for cytokine treatment of human islets to evaluate the activation of hypoxia inducible factor 1 α (HIF1α) targets, in vitro.

Actions biochimiques/physiologiques

IFN-γ is a dimerized soluble cytokine that is the only member of the type II class of interferons.
Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses. IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells. This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity. In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.

Séquence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Remarque sur l'analyse

The biological activity of recombinant human IFN-γ was tested in culture in a viral resistance assay. The ED50 is defined as the effective concentration of IFN-γ that allows 50% cell growth in an antiviral cell based bioassay.

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 2

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Class II cytokine receptors and their ligands: key antiviral and inflammatory modulators.
Renauld J C.
Nature Reviews: Immunology, 3(8), 667-667 (2003)
The IFNγ receptor: a paradigm for cytokine receptor signaling.
Bach E A, et al.
Annual Review of Immunology, 15(1), 563-591 (1997)
Expression and reconstitution of a biologically active mouse interferon gamma receptor in hamster cells. Chromosomal location of an accessory factor.
Hibino Y, et al.
The Journal of Biological Chemistry, 266(11), 6948-6951 (1991)
Clinical use of interferon?γ.
Miller C H, et al.
Annals of the New York Academy of Sciences, 1182(1), 69-79 (2009)
Inhibition of LSD1 with Bomedemstat Sensitizes Small Cell Lung Cancer to Immune Checkpoint Blockade and T-Cell Killing.
Hiatt, et al.
Clinical Cancer Research, 28, 4551-4564 (2023)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique