HPA031471

Anti-ABCG1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2

• Synonyme(s) : Anti-ABC8, Anti-ATP-binding cassette, sub-family G (WHITE), member 1
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA031471
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCL
• Numéro d'accès UniProt: P45844
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ABCG1(9619)

Description

Description générale

ABCG1 (ATP-binding cassette G1) gene is mapped to human chromosome 21q22.3 The encoded protein belongs to the G subfamily of ATP binding cassette (ABC) transporters. ABCG1 is expressed highly in neurons and glia in the central nervous system, brain, spleen and lungs. In mammals, most of the ABC transporters are present in the plasma membrane and are involved in the passage of substances from the inside of the cell to the outside space. Various ABC transporters are known to localize and function in intracellular compartments.

Immunogène

ATP-binding cassette, sub-family G (WHITE), member 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

ABCG1 (ATP-binding cassette G1) mediates cholesterol efflux to HDL (high density lipoprotein) for reverse cholesterol transport, in order to eliminate intracellular cholesterol. The encoded protein controls the removal of excess cholesterol from peripheral tissues and transports it to the liver. Therefore, it is involved in sterol and glucose homeostasis. Deficiency of ABCG1 in mice leads to severe age-dependent pulmonary lipidosis. ABCG1 is known to be associated with a risk for Alzheimer′s disease. Deletion of ABCG1 gene in mice model has been shown to cause excess accumulation of neutral lipids and phospholipids in hepatocytes and in macrophages. Lack of this gene decreases tumor growth and augments tumor cellular apoptosis. It also serves as a potential candidate for affective disorders or suicidal behavior.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST78825

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable