Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV37583

Sigma-Aldrich

Anti-E2F7 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-A630014C11Rik, Anti-D10Ertd739e, Anti-E2F transcription factor 7

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

99 kDa

Espèces réactives

mouse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_848724

Numéro d'accès UniProt

Q6S7F2

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

mouse ... E2f7(52679)

Description générale

E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 7 (E2F7) which is highly expressed during mid to late S-phase binds to the promoter regions of and represses G(1)/S-regulated genes thus promoting the downswing of oscillating G(1)/S genes during S-phase progression.

The previously assigned protein identifier Q8BSQ3 has been merged into Q6S7F2. Full details can be found on the UniProt database.

Spécificité

Anti-E2F7 polyclonal antibody reacts with human, rat, canine, bovine, and mouse E2F transcription factor 7 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of mouse E2f7

Application

Anti-E2F7 polyclonal antibody is used to tag E2F transcription factor 7 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E2F transcription factor 7 in the regulation of cell proliferation, especially at the level of G(1)/S gene activity during S-phase progression.

Actions biochimiques/physiologiques

E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts

Séquence

Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Zhongkui Jin et al.
Hereditas, 161(1), 27-27 (2024-08-28)
Circular RNAs (circRNAs) are capable of affecting breast cancer (BC) development. However, the role and underneath mechanism of circFKBP8 (also known as hsa_circ_0000915) in BC remain largely unknown. Expression analyses were performed using quantitative real-time polymerase chain reaction (qRT-PCR), western
Marie-Claude Perry et al.
Molecular and cellular biology, 34(23), 4232-4243 (2014-09-24)
The tyrosine kinase receptor ERBB2 is required for normal development of the heart and is a potent oncogene in breast epithelium. Trastuzumab, a monoclonal antibody targeting ERBB2, improves the survival of breast cancer patients, but cardiac dysfunction is a major

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique