SAB2102351

Anti-SYNJ1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-INPP5G, Anti-Synaptojanin 1
• MDL number: MFCD04118693
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 143 kDa
• species reactivity: human, rabbit, pig, horse, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: O43426
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SYNJ1(8867)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human SYNJ1

Biochem/physiol Actions

Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.Synaptojanin-1 is a phosphatidylinositol (4,5)-bisphosphate (PI(4,5)P2) that has a role in clathrin-coated pit dynamics Perera et al. (2006) [PubMed 17158794].[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3383 AB020717.2 1-3383 3384-3539 AF009040.1 3318-3473 3540-4183 AF009039.1 3522-4165 4184-7039 AB020717.2 4142-6997

Sequence

Synthetic peptide located within the following region: IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable