WH0004780M1

Monoclonal Anti-NFE2L2 antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-NRF2, Anti-nuclear factor (erythroid-derived 2)-like 2
• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1F3, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: suitable
• Isotipo: IgG2bκ
• Sequenza immunogenica: FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA (without GST)
• N° accesso UniProt: Q16236
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... NFE2L2(4780)

Descrizione

Immunogeno

NFE2L2 (AAH11558, a.a. 71-170) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Stato fisico

Solution in phosphate buffered saline, pH 7.2

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)