Passa al contenuto
Merck
Tutte le immagini(8)

Documenti fondamentali

WH0002597M1

Sigma-Aldrich

Anti-GAPDH Antibody

mouse monoclonal, 3C2

Sinonimo/i:

Anti-G3PD, Anti-GAPD, Anti-MGC88685, Anti-glyceraldehyde-3-phosphate dehydrogenase

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41
Coniugato:
unconjugated
application:
ELISA (i)
WB
Clone:
3C2, monoclonal
Reattività contro le specie:
human
citations:
21
tecniche:
indirect ELISA: suitable
western blot: 1-5 μg/mL

Nome del prodotto

Monoclonal Anti-GAPDH antibody produced in mouse, clone 3C2, purified immunoglobulin, buffered aqueous solution

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3C2, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... GAPDH(2597)

Descrizione generale

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), a classic glycolytic enzyme, is a multi-functional protein. It is mainly present in the cytoplasm. GAPDH is ubiquitously expressed. The GAPDH gene is located on human chromosome 12.
The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. (provided by RefSeq)

Immunogeno

GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Applicazioni

Monoclonal Anti-GAPDH antibody produced in mouse has been used in western blot, (1:5000), and (1:2,000).

Azioni biochim/fisiol

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) participates in energy metabolism. It might have extra glycolytic roles in DNA repair. GAPDH plays a key role in glycolysis and several non-glycolytic actions. GAPDH binds to microtubules and regulates microtubule bundling and aids in membrane fusion. GAPDH participates in gene transcription, DNA replication, and nuclear RNA export. GAPDH acts as a uracil DNA glycosylase (UDG) that plays a role in DNA repair. It also acts as a mediator for cell death. GAPDH may play a role in Alzheimer′s disease (AD). It can be a potential therapeutic target in chemotherapy. Overexpression of the GAPDH gene in the T cell lineage is associated with angioimmunoblastic T cell lymphoma.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

12 - Non Combustible Liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

I clienti hanno visto anche

Slide 1 of 3

1 of 3

Xu Han et al.
Journal of cellular biochemistry, 120(8), 12966-12976 (2019-04-20)
Endocrine therapy resistance represents a major challenge to the successful treatment of patients with breast cancer. The development of tamoxifen resistance commonly occurrs during the treatment of patients with breast cancer whereas its underlying mechanisms remain elusive. Here, we found
Le Lu et al.
Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 68(1), 13-19 (2013-11-12)
Abnormal microRNA expression is a common and important feature of human malignancies. Matrix metalloproteinase 2 (MMP2), which has been reported in several cancers, plays important roles in cancer progression. However, the microRNA regulatory mechanism on MMP2 expression remains unclear. In
W Wang et al.
Clinical and experimental allergy : journal of the British Society for Allergy and Clinical Immunology, 42(11), 1604-1614 (2012-10-31)
Unlike other IL-17 family members, the Th2-derived cytokine IL-25 (IL-17E) induces (promotes) Th2 responses. One or both of the two receptors for IL-25 (IL-17RA, IL-17RB) is expressed on inflammatory cells and tissue structural cells, suggesting that in addition to promoting
Bo Zhan et al.
Experimental and therapeutic medicine, 13(5), 2473-2479 (2017-06-02)
Kidney cancer is among the most important causes of cancer-associated mortality worldwide. The present study aimed to evaluate protein kinase C α (PKCα) expression in kidney cancer tissues and cell lines, and its significance in apoptosis and migration. Expression of
Makoto R Hara et al.
Biochimica et biophysica acta, 1762(5), 502-509 (2006-04-01)
Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) is a classic glycolytic enzyme, and accumulating evidence has suggested that GAPDH is a multi-functional protein. In particular, its role as a mediator for cell death has been highlighted. For the last decade, many groups reported that

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.