SAB5702017

[KD Validated]Anti-PCSK9 Antibody, clone 9L4U5, Rabbit Monoclonal

• Sinonimo/i: FH3, HCHOLA3, LDLCQ1, NARC-1, NARC1, PC9
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 9L4U5, monoclonal
• Forma fisica: liquid
• Reattività contro le specie: human
• Concentrazione: 1 mg/mL
• tecniche: western blot: 1:500 - 1:1000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: EASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
• N° accesso UniProt: Q8NBP7
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PCSK9(255738)

Descrizione

Descrizione generale

This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Mutations in this gene have been associated with autosomal dominant familial hypercholesterolemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 593-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB

Informazioni sulla sicurezza

• Pittogrammi: GHS07,GHS09
• Avvertenze: Warning
• Indicazioni di pericolo: H317,H411
• Consigli di prudenza: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classi di pericolo: Aquatic Chronic 2 - Skin Sens. 1
• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3