SAB1412638

ANTI-SMG1 antibody produced in mouse

clone 4E4, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: 61E3.4, ATX, KIAA0421, LIP, SMG1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 4E4, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 37.84 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso NCBI: NM_014006
• N° accesso UniProt: Q96Q15
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SMG1(23049)

Descrizione

Descrizione generale

This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined. (provided by RefSeq)

Immunogeno

SMG1 (NP_055535, 2922 a.a. ~ 3031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable