SAB1403798

Monoclonal Anti-F3 antibody produced in mouse

clone 4G4, ascites fluid

• Sinonimo/i: CD142, TF, TFA
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: ascites fluid
• Tipo di anticorpo: primary antibodies
• Clone: 4G4, monoclonal
• PM: antigen ~38.21 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgG2aκ
• N° accesso NCBI: BC011029
• N° accesso UniProt: P13726
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... F3(2152)

Descrizione

Descrizione generale

This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. (provided by RefSeq)

Immunogeno

F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK

Stato fisico

Clear solution

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable