SAB1402559

Monoclonal Anti-PVRL3 antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1D1, monoclonal
• Stato: buffered aqueous solution
• PM: antigen ~37.99 kDa
• Reattività contro le specie: human
• tecniche: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_015480
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PVRL3(25945)

Descrizione

Descrizione generale

Poliovirus receptor-related 3 (PVRL3), popularly known as nectin cell adhesion molecule 3 (NECTIN3), is expressed in various cells. It is part of the nectin family of proteins, which are cell adhesion molecules that modulate adherens junction formation. PVRL3 is a membrane protein with three extracellular immunoglobulin domains. The gene encoding it is localized on human chromosome 3q13.13.

Immunogeno

PVRL3 (NP_056295, 59 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTV

Applicazioni

Monoclonal Anti-PVRL3 antibody produced in mouse has been used for immunohistochemistry.

Azioni biochim/fisiol

Poliovirus receptor-related 3 (PVRL3) or nectin cell adhesion molecule 3 (NECTIN3) forms heterotypic adhesions with PVR, PVRL1 and PVRL2. The protein is involved in lymphocyte and monocyte extravasation. It also associates with afadin. PVRL3 has a role in the development of mammalian lens and ciliary body.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable