HPA031736
Anti-TTBK1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinonimo/i:
Anti-KIAA1855, Anti-Tau tubulin kinase 1
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Scegli un formato
100 μL
CHF 556.00
CHF 556.00
Spedizione prevista il02 giugno 2025
Scegli un formato
Cambia visualizzazione
100 μL
CHF 556.00
About This Item
CHF 556.00
Spedizione prevista il02 giugno 2025
Prodotti consigliati
Origine biologica
rabbit
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Nome Commerciale
Prestige Antibodies® Powered by Atlas Antibodies
Stato
buffered aqueous glycerol solution
Reattività contro le specie
human
Convalida avanzata
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
tecniche
immunohistochemistry: 1:1000- 1:2500
Sequenza immunogenica
RLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAAALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQ
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... TTBK1(84630)
Categorie correlate
Descrizione generale
The gene TTBK1 (tau tubulin kinase 1) is mapped to human chromosome 6p21.1. It is a serine/threonine and tyrosine kinase. TTBK1 belongs to the casein kinase 1 superfamily and is neuron-specific. The encoded protein has a kinase domain, a unique polyglutamate domain and several PEST (proline–glutamate–serine–threonine) sequences.
Immunogeno
tau tubulin kinase 1 recombinant protein epitope signature tag (PrEST)
Applicazioni
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Azioni biochim/fisiol
TTBK1 (tau tubulin kinase 1) is responsible for phosphorylation of TDP-43 (TAR DNA binding protein), a protein associated with amyotrophic lateral sclerosis and frontotemporal lobar dementia. High expression or abundance of TTBK1 might be associated with neurodegeneration in these diseases. It also phosphorylates tau protein and might be associated with Alzheimer′s disease progression.
Caratteristiche e vantaggi
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST77601
Stato fisico
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Note legali
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
The structure of human tau-tubulin kinase 1 both in the apo form and in complex with an inhibitor.
Kiefer SE, et al.
Acta Crystallographica. Section F, Structural Biology Communications, 70, 173-181 (2014)
Tau-tubulin kinase 1 (TTBK1), a neuron-specific tau kinase candidate, is involved in tau phosphorylation and aggregation.
Sato S, et al.
Journal of Neurochemistry, 98, 1573-1584 (2006)
Nicole F Liachko et al.
PLoS genetics, 10(12), e1004803-e1004803 (2014-12-05)
Pathological aggregates of phosphorylated TDP-43 characterize amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD-TDP), two devastating groups of neurodegenerative disease. Kinase hyperactivity may be a consistent feature of ALS and FTLD-TDP, as phosphorylated TDP-43 is not observed in the
Lucia Binó et al.
Scientific reports, 13(1), 12884-12884 (2023-08-10)
Primary cilia are key regulators of embryo development and tissue homeostasis. However, their mechanisms and functions, particularly in the context of human cells, are still unclear. Here, we analyzed the consequences of primary cilia modulation for human pluripotent stem cells
Active Filters
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.
