HPA011026

Anti-ARHGEF11 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-PDZ-RhoGEF, Anti-Rho guanine nucleotide exchange factor 11
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA011026
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: recombinant expression; independent; Learn more about Antibody Enhanced Validation
• tecniche: immunohistochemistry: 1:50-1:200; western blot: 0.04-0.4 μg/mL
• Sequenza immunogenica: LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEQDA
• N° accesso UniProt: O15085
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ARHGEF11(9826)

Descrizione

Descrizione generale

ARHGEF11 (Rho guanine nucleotide exchange factor (GEF) 11) belongs to the family of Rho guanine nucleotide exchange factors (GEFs). It shares homology to ARHGEF1 and ARHGEF12, and regulates G-protein signaling. This gene maps to human chromosome 1q21, and is expressed in a wide range of tissues such as, adipose tissue, liver, pancreas and muscle. This protein contains a PDZ (PSD-95, Disc-large, ZO1) domain and a G protein signaling (RGS) domain.

Immunogeno

Rho guanine nucleotide exchange factor 11 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-ARHGEF11 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Azioni biochim/fisiol

ARHGEF11 (Rho guanine nucleotide exchange factor (GEF) 11) induces Rho-GTPases, which modulate G protein signaling. It is involved in the regulation of lipid metabolism, insulin secretion and signaling. It also plays a part in axonal guidance. ARHGEF11 contains an actin-binding domain, and therefore, may play a role in determining the structure of actin cytoskeleton. R1467H variant of this gene might be responsible for increased susceptibility to type 2 diabetes mellitus in Chinese and German Caucasian population. It also interacts with RhoA, myosin II, and actomyosin, to establish cell polarity.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70694

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)