HPA010122

Anti-DLG4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Disks large homolog 4, Anti-PSD-95, Anti-Postsynaptic density protein 95, Anti-SAP90, Anti-Synapse-associated protein 90
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA010122
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• tecniche: immunohistochemistry: 1:200- 1:500
• Sequenza immunogenica: HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR
• N° accesso UniProt: P78352
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... DLG4(1742)

Descrizione

Descrizione generale

DLG4 (discs large homolog 4) gene is localized to human chromosome 17p13.1. It is an abundantly present scaffolding protein. It is a multi-domain protein, which is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins. This protein family is characterized by PSD-95/discs large/ZO-1 (PDZ)-Src homology 3 (SH3)-guanylate kinase domain. DLG4 is localized to the cytoplasmic ends of postsynaptic terminals.

Immunogeno

Disks large homolog 4 recombinant protein epitope signature tag (PrEST)

Applicazioni

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Azioni biochim/fisiol

Knockout (KO) mice for DLG4 (discs large homolog 4) are characterized by aberrant synaptic plasticity and impaired spatial learning. Polymorphisms in this gene at the core promoter region and the 3′ and 5′ UTR (untranslated regions) control its expression, which in turn is associated with susceptibility to schizophrenia. It couples the activity of N-methyl-D-aspartate receptors (NMDARs) to neurotoxicity by NO (nitric oxide), and is also responsible for specificity to excitotoxic Ca²⁺ signaling. This protein functions in the postsynapse at excitatory neurons, where it is responsible for the clustering of glutamate receptors and organization of macromolecular complexes for signal integration. In Alzheimer′s diseases, an increase in the expression of this protein is linked with increase in β-amyloid and phosphorylated Tau proteins.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71165

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)