Passa al contenuto
Merck
Tutte le immagini(7)

Documenti fondamentali

HPA008999

Sigma-Aldrich

Anti-EFNB2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-EPH-related receptor tyrosine kinase ligand 5 antibody produced in rabbit, Anti-Ephrin-B2 precursor antibody produced in rabbit, Anti-HTK ligand antibody produced in rabbit, Anti-HTK-L antibody produced in rabbit, Anti-LERK-5 antibody produced in rabbit

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Sequenza immunogenica

YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... EFNB2(1948)

Descrizione generale

EFNB2 (ephrin-B2) is a member of the B-class ephrins, which function as ligands for EphB RTKs (receptor tyrosine kinase). It is a transmembrane protein. It is a cell surface signaling glycoprotein, which has a ubiquitous expression pattern. EFNB2 is expressed in mesenchymal cells, with the highest expression in fibroblast. EFNB2 gene is located on human chromosome 13q33.3.

Immunogeno

Ephrin-B2 precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-EFNB2 antibody produced in rabbit has been used in:
  • immunohistochemistry (1:100)
  • western blot analysis (1:1000)
  • immunostaining

Anti-EFNB2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

Ephrin-B2 (EFNB2) regulates sprouting and proliferation of endothelial cells in the endothelium of the developing vasculature. This is in turn, linked with vascular endothelial growth factor (VEGF) receptor endocytosis and signaling. It is crucial in supporting pericytes and vascular smooth muscle cells (VSMCs). It also functions as the regulator of the distribution, internalization and signaling of platelet-derived growth factor receptor β (PDGFRβ) in VSMCs. In castration resistant prostate cancer (CRPC), the expression of this gene is directly suppressed by miR-582-5p. Therefore, it might function as a tumor suppressor functioning through EphB4, in cancer cells expressing EphB4. This protein is responsible for the induction of neuronal differentiation of neural stem cells (NSCs), when presented by neighbouring astrocytes. EFNB2 participates in the development of the cardiovascular system, postnatal angiogenesis, and cardiac remodeling. It serves as a modulator in transforming growth factor-ß (TGF-ß)-mediated organ fibrosis.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71886

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Benhur Lee et al.
Proceedings of the National Academy of Sciences of the United States of America, 112(17), E2156-E2165 (2015-04-01)
The discovery of African henipaviruses (HNVs) related to pathogenic Hendra virus (HeV) and Nipah virus (NiV) from Southeast Asia and Australia presents an open-ended health risk. Cell receptor use by emerging African HNVs at the stage of host-cell entry is
Essential roles of EphrinB2 in mammalian heart: from development to diseases
Su S-an, et al.
Cell communication and signaling : CCS (2019)
Atsushi Maeno et al.
The Prostate, 74(16), 1604-1612 (2014-09-02)
MicroRNAs are noncoding small RNA that negatively regulate target gene expression by binding to the 3'-UTR of mRNA. Previous studies have shown that several microRNAs play a pivotal role in prostate cancer by acting as oncogenes or tumor suppressors. This
Alexander Schwickert et al.
Reproductive sciences (Thousand Oaks, Calif.) (2021-11-13)
In placenta percreta cases, large vessels are present on the precrete surface area. As these vessels are not found in normal placentation, we examined their histological structure for features that might explain the pathogenesis of neoangiogenesis induced by placenta accreta
David Lagares et al.
Nature medicine, 23(12), 1405-1415 (2017-10-24)
Maladaptive wound healing responses to chronic tissue injury result in organ fibrosis. Fibrosis, which entails excessive extracellular matrix (ECM) deposition and tissue remodeling by activated myofibroblasts, leads to loss of proper tissue architecture and organ function; however, the molecular mediators

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.