Passa al contenuto
Merck
Tutte le immagini(6)

Documenti fondamentali

HPA008356

Sigma-Aldrich

Anti-RET antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

RET Antibody - Anti-RET antibody produced in rabbit, Ret Antibody, Anti-CDHF12, Anti-CDHR16, Anti-HSCR1, Anti-MEN2A, Anti-MEN2B, Anti-MTC1, Anti-PTC, Anti-RET51

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 493.00

CHF 493.00


Check Cart for Availability


Scegli un formato

Cambia visualizzazione
100 μL
CHF 493.00

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.43

CHF 493.00


Check Cart for Availability

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

tecniche

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Sequenza immunogenica

NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... RET(5979)

Descrizione generale

Proto-oncogene tyrosine-protein kinase receptor Ret (RET) is a receptor for the glial derived neurotrophic factor (GDNF) family of ligands. RET gene codes for the RET receptor protein. RET is predominantly found in the plasma membrane and the cytoplasm. It is mainly expressed in neural tissues, neuroendocrine cells, the digestive tract, adult kidneys, skin, and blood apparatus. RET has an extracellular region, a transmembrane region, and a cytoplasmic region. It also has four cadherin-like domains, a cysteine-rich domain, and calcium-binding sites. RET gene is located on human chromosome 10q11.21.

Immunogeno

Proto-oncogene tyrosine-protein kinase receptor ret precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-RET antibody produced in rabbit has been used in immunohistochemical analysis[1] (1:250).[2]

Azioni biochim/fisiol

Proto-oncogene tyrosine-protein kinase receptor Ret (RET) has four ligands-glial cell-derived neurotrophic factor (GDNF), neurturin, artemin and persephin. The binding of these ligands needs a GPI-anchored coreceptor (GFRα1-4). RET plays an important role in kidney and neural development, and maintains the number of somatotrophs at physiological levels. RET controls a complex network of signaling pathways in enteric nervous system progenitor cells during their development, survival, proliferation, differentiation, and migration. RET gene mutations are associated with medullary thyroid carcinoma (MTC), multiple endocrine neoplasia type 2A (MEN2A), familial medullary thyroid carcinomas (FMTC), multiple endocrine neoplasia type 2B (MEN2B), familial pheochromocytoma predisposition, Hirschsprung disease, congenital central hypoventilation syndrome, and renal hypodysplasia/aplasia 1. It possesses tyrosine kinase activity.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71122

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Qiufu Ma
Neuron, 64(6), 773-776 (2010-01-13)
The rapidly adapting (RA) low-threshold mechanoreceptors respond to movement of the skin and vibration and are critical for the perception of texture and shape. In this issue of Neuron, two papers (Bourane et al. and Luo et al.) demonstrate that
RET (REarranged during Transfection)
Huret JL and Wan-Senon SYC
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2020)
Snehal Dabir et al.
Journal of thoracic oncology : official publication of the International Association for the Study of Lung Cancer, 9(9), 1316-1323 (2014-08-15)
There is growing interest in defining the somatic mutations associated with small-cell lung cancer (SCLC). Unfortunately, a serious blockade to genomic analyses of this disease is a limited access to tumors because surgery is rarely performed. We used our clinical/pathologic
Diversity of mutations in the RET proto-oncogene and its oncogenic mechanism in medullary thyroid cancer
Hedayati M, et al.
Critical Reviews in Clinical Laboratory Sciences, 217-227 (2015)
Montserrat Garcia-Lavandeira et al.
Frontiers of hormone research, 38, 127-138 (2010-07-10)
The RET receptor is a tyrosine kinase receptor implicated in kidney and neural development. In the adenopituitary RET and the co-receptor GFRa1 are expressed exclusively in the somatotrophs secreting GH. RET is implicated in a clever pathway to maintain at

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.