HPA007856

Anti-CCAR1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-CARP-1 antibody produced in rabbit, Anti-Cell cycle and apoptosis regulatory protein 1 antibody produced in rabbit, Anti-Cell division cycle and apoptosis regulator protein 1 antibody produced in rabbit, Anti-Death inducer with SAP domain antibody produced in rabbit
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA007856
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: mouse, rat, human
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• Sequenza immunogenica: KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED
• N° accesso UniProt: Q8IX12
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CCAR1(55749)

Descrizione

Immunogeno

Cell division cycle and apoptosis regulator protein 1 recombinant protein epitope signature tag (PrEST)

Applicazioni

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Azioni biochim/fisiol

CCAR1 (cell division cycle and apoptosis regulator 1) gene encodes a co-activator protein that associates with and recruits components of the mediator and p160 coactivator complexes by nuclear receptors (NR) to target genes. In response to appropriate hormone, it is recruited to endogenous NR target genes. It is involved in the regulation of genes that are involved in cell proliferation. It also functions as a p53 coactivator and regulates transcription. Cellular stress induces microtubule-dependent formation of RNA stress granules via CCAR1 and AKAP350A, a multifunctional scaffolding protein. It is a perinuclear protein that mediates apoptosis signaling and activates caspase 9 and 3, thereby exhibiting pro-apoptotic action.[1] It also functions as a coactivator of androgen receptor (AR) and facilitates the formation of AR transcription complex. It functions in androgen signaling and prostate tumorigenesis.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71479

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)