AV54329
Anti-IL4 antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-BSF1, Anti-IL-4, Anti-Interleukin 4, Anti-MGC79402
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
15 kDa
Reattività contro le specie
human
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
Informazioni sul gene
human ... IL4(3565)
Categorie correlate
Immunogeno
Synthetic peptide directed towards the middle region of human IL4
Applicazioni
Anti-IL4 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Azioni biochim/fisiol
Interleukin-4 (IL-4) is a T cell derived chemokine that stimulates the Th2 mediated immune response and proliferation of B cells. The effects of IL-4 are mediated by two types of receptors, type I receptor consisting of IL-4Rα and common γ chain and type II receptor composed of IL-4Rα and IL-13Rα1. The signalling stimulated by IL-4 leads to activation of JAK/STAT6 and IRS-mediated PI3K/Akt pathway. Through these pathways, IL-4 is responsible for endocytic activity of macrophages, chemotaxis of leukocytes in response to inflammation, angiogenesis and regulation of nitric oxide metabolism in macrophages. Anti-tumor effects of IL-4 have been reported in cancers of breast, liver and renal cells.
Sequenza
Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Michal Kuczma et al.
Journal of immunotoxicology, 11(4), 319-327 (2013-12-20)
Immunotherapy is becoming an increasingly attractive therapeutic alternative for conventional cancer therapy. In recent years Foxp3(+) regulatory T-cells (T(R)) were identified as the major obstacle to effective cancer immunotherapy. The abundance of these cells in peripheral blood is increased in
C K Oh et al.
European respiratory review : an official journal of the European Respiratory Society, 19(115), 46-54 (2010-10-20)
Asthma is a complex, persistent, inflammatory disease characterised by airway hyperresponsiveness in association with airway inflammation. Studies suggest that regular use of high-dose inhaled corticosteroids and long-acting bronchodilators or omalizumab (a humanised monoclonal antibody that binds to immunoglobulin E and
Kerstin Göbel et al.
European journal of immunology, 44(8), 2295-2305 (2014-05-09)
Lymphocyte adhesion and subsequent trafficking across endothelial barriers are essential steps in various immune-mediated disorders of the CNS, including MS. The molecular mechanisms underlying these processes, however, are still unknown. Phospholipase D1 (PLD1), an enzyme that generates phosphatidic acid through
Julie Ann et al.
Vaccine, 32(43), 5730-5739 (2014-09-01)
Influenza viruses are major respiratory pathogens and the development of improved vaccines to prevent these infections is of high priority. Here, we evaluated split inactivated A(H3N2) vaccines (A/Uruguay/716/2007) combined or not with adjuvants (AS03, AS25 and Protollin) and administered by
Smanla Tundup et al.
Infection and immunity, 82(8), 3240-3251 (2014-05-29)
Antigen-presenting cell (APC) plasticity is critical for controlling inflammation in metabolic diseases and infections. The roles that pattern recognition receptors (PRRs) play in regulating APC phenotypes are just now being defined. We evaluated the expression of PRRs on APCs in
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.