Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV53846

Sigma-Aldrich

Anti-PRKAA1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-AMPK, Anti-AMPKa1, Anti-MGC33776, Anti-MGC57364, Anti-Protein kinase, AMP-activated, α 1 catalytic subunit

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203

Origine biologica

rabbit

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

62 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PRKAA1(5562)

Descrizione generale

PRKAA1 gene encodes the catalytic α-subunit of 5′ AMP-activated protein kinase (AMPK) that belongs to ser/thr protein kinase family and is localized both in the cytoplasm and in the nucleus. AMPK is a heterotrimeric complex consists of a catalytic α subunit and regulatory β and γ subunits.

Immunogeno

Synthetic peptide directed towards the N terminal region of human PRKAA1

Applicazioni

Anti-PRKAA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Azioni biochim/fisiol

AMPK is a cellular energy sensor present in all eukaryotic cells. It is stimulated by high AMP and low ATP concentration and regulates the activities of a number of key metabolic enzymes through allosteric mechanism. Increasing concentrations of AMP during the energy shortage stimulates phosphorylation by an upstream protein kinase and inhibits dephosphorylation, resulting in activation of catabolic pathways and switching off of ATP-consuming biosynthetic pathways. PRKAA1 also facilitates the autophagy-mediated damaged mitochondria clearance for erythrocyte maturation and homeostasis. Additionally, AMPK phosphorylates TSC2 to protect cells from energy deprivation-induced apoptosis and regulates cell growth and survival.

Sequenza

Synthetic peptide located within the following region: GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

Codice della classe di stoccaggio

12 - Non Combustible Liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Sukriti Krishan et al.
Journal of clinical pathology, 67(9), 758-763 (2014-06-05)
The PRKAA1 gene encodes the catalytic α-subunit of 5′ AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor that maintains energy homeostasis within the cell and is activated when the AMP/ATP ratio increases. When activated, AMPK increases catabolic processes
Elżbieta Sarnowska et al.
Postepy higieny i medycyny doswiadczalnej (Online), 67, 750-760 (2013-09-11)
AMP-activated protein kinase (AMPK) is one of the major energy sensor at both: cellular and whole body level. It exists as heterotrimer containing three subunits: the catalytic α subunit, β and regulatory γ. AMPK is localized both in the cytoplasm
Ken Inoki et al.
Cell, 115(5), 577-590 (2003-12-04)
Mutations in either the TSC1 or TSC2 tumor suppressor gene are responsible for Tuberous Sclerosis Complex. The gene products of TSC1 and TSC2 form a functional complex and inhibit the phosphorylation of S6K and 4EBP1, two key regulators of translation.
Huaiping Zhu et al.
Autophagy, 10(9), 1522-1534 (2014-07-06)
AMP-activated protein kinase α1 knockout (prkaa1(-/-)) mice manifest splenomegaly and anemia. The underlying molecular mechanisms, however, remain to be established. In this study, we tested the hypothesis that defective autophagy-dependent mitochondrial clearance in prkaa1(-/-) mice exacerbates oxidative stress, thereby enhancing
Abubakar Wani et al.
Autophagy, 17(11), 3813-3832 (2021-01-07)
Alzheimer disease (AD) is usually accompanied by two prominent pathological features, cerebral accumulation of amyloid-β (Aβ) plaques and presence of MAPT/tau neurofibrillary tangles. Dysregulated clearance of Aβ largely contributes to its accumulation and plaque formation in the brain. Macroautophagy/autophagy is

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.