Passa al contenuto
Merck
Tutte le immagini(3)

Documenti

AV51158

Sigma-Aldrich

Anti-APOH antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Apolipoprotein H (β-2-glycoprotein I), Anti-B2G1, Anti-BG

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(3)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

36 kDa

Reattività contro le specie

human, dog, pig, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_000033

N° accesso UniProt

P02749

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... APOH(350)

Immunogeno

Synthetic peptide directed towards the N terminal region of human APOH

Applicazioni

Anti-APOH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Azioni biochim/fisiol

Apolipoprotein H (APOH; beta-2-glycoprotein I) is a phospholipid implicated in lipid metabolism, coagulation and production of antiphospholipid autoantibodies. It functions as a cofactor required for the binding of antiphospholipid antibodies present in the sera of lupus and antiphospholipid syndrome patients.

Sequenza

Synthetic peptide located within the following region: LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

beta 2 Glycoprotein I--a key player in the antiphospholipid syndrome.
Bianca C H Lutters et al.
The Israel Medical Association journal : IMAJ, 4(11 Suppl), 958-962 (2002-11-29)
Gerard Espinosa et al.
Arthritis research & therapy, 10(6), 230-230 (2008-12-19)
Antiphospholipid syndrome is diagnosed when arterial or venous thrombosis or recurrent miscarriages occur in a person in whom laboratory tests for antiphospholipid antibodies (anticardiolipin antibodies and/or lupus anticoagulant and/or anti-beta 2-glycoprotein I) are positive. Despite the strong association between antiphospho-lipid
Zeljka Vogrinc et al.
Clinical chemistry and laboratory medicine, 43(1), 17-21 (2005-01-18)
Apolipoprotein H (apoH) is considered to be a necessary cofactor for the binding of certain antiphospholipid antibodies to anionic phospholipids. Some apoH-dependent antiphospholipid antibodies also exert lupus anticoagulant (LA) activity, which seems to depend on antiphospholipid antibody epitope specificity. The

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.