AV51158

Anti-APOH antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Apolipoprotein H (β-2-glycoprotein I), Anti-B2G1, Anti-BG
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 3

Proprietà

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 36 kDa
• species reactivity: human, dog, pig, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_000033
• UniProt accession no.: P02749
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... APOH(350)

Descrizione

Immunogen

Synthetic peptide directed towards the N terminal region of human APOH

Application

Anti-APOH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Biochem/physiol Actions

Apolipoprotein H (APOH; beta-2-glycoprotein I) is a phospholipid implicated in lipid metabolism, coagulation and production of antiphospholipid autoantibodies. It functions as a cofactor required for the binding of antiphospholipid antibodies present in the sera of lupus and antiphospholipid syndrome patients.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Classe di stoccaggio: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable