Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV48203

Sigma-Aldrich

Anti-ENO3 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Enolase 3 (β, muscle), Anti-MSE

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 354.00

CHF 354.00


Check Cart for Availability


Scegli un formato

Cambia visualizzazione
100 μL
CHF 354.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 354.00


Check Cart for Availability

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

47 kDa

Reattività contro le specie

goat, rat, dog, horse, rabbit, mouse, guinea pig, bovine, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ENO3(2027)

Descrizione generale

Enolase 3 (ENO3) is a skeletal muscle isoenzyme that is involved in muscle development. ENO3 transcription is regulated by muscle-specific enhancer proteins. Mutations in ENO3 have been linked to glycogen storage diseases.
Rabbit Anti-ENO3 antibody recognizes bovine, canine, rabbit, human, mouse, and rat ENO3.

Immunogeno

Synthetic peptide directed towards the N terminal region of human ENO3

Applicazioni

Rabbit Anti-ENO3 antibody is suitable for western blot applications at 5 μg/ml and for IHC at 4-8 μg/ml.

Azioni biochim/fisiol

ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5′ UTR.

Sequenza

Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

S Feo et al.
Molecular and cellular biology, 15(11), 5991-6002 (1995-11-01)
To provide evidence for the cis-regulatory DNA sequences and trans-acting factors involved in the complex pattern of tissue- and stage-specific expression of the beta enolase gene, constructs containing fragments of the gene fused to the chloramphenicol acetyltransferase gene were used

Questions

  1. Sir, Can be use this antibody for ELISA for detecting ENO3 in saliva?

    1 answer
    1. Unfortunately, this product has not been tested for use in ELISA. The end user would have to determine suitability.

      Helpful?

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.