AV47876

Anti-LAB antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-BG:DS00004.9, Anti-CG1264, Anti-DmLab, Anti-Dmel_CG1264, Anti-EfR9, Anti-F121, Anti-F24
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 54 kDa
• Reattività contro le specie: human, Drosophila
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_476613
• N° accesso UniProt: P10105
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: Drosophila melanogaster ... lab(40817)

Descrizione

Descrizione generale

Labial (LAB) is a Drosophila transcription factor that regulates brain, midgut and embryo development. It is also known to modulate cell fate decisions and cell differentiation.
Rabbit Anti-LAB antibody recognizes Drosophila LAB.

Immunogeno

Synthetic peptide corresponding to a region of Fruit fly

Applicazioni

Rabbit Anti-LAB antibody is suitable for western blot applications at a concentration of 1μg/ml and for IHC at 4-8μg/ml.

Azioni biochim/fisiol

lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

Sequenza

Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable