AV43518

Anti-GOT2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Got2 Antibody, Got2 Antibody - Anti-GOT2 (AB2) antibody produced in rabbit, Anti-FLJ40994, Anti-Glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2), Anti-Kat4, Anti-Kativ, Anti-Mitaat
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 45 kDa
• Reattività contro le specie: rat, rabbit, dog, mouse, horse, human, guinea pig, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_002071
• N° accesso UniProt: P00505
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... GOT2(2806)

Descrizione

Descrizione generale

Glutamic-oxaloacetic transaminase 2 (GOT2) in an inner-membrane mitochondrial enzyme that interconverts the amino acids aspartate and glutamate and the TCA cycle components α-ketoglutarate and oxaloacetate. The enzyme facilitates a balance between energy metabolism and amino acid composition.

Specificità

Anti-GOT2 (AB2) polyclonal antibody reacts with bovine, pig, chicken, human, mouse, rat, and zebrafish mitochondrial aspartate aminotransferases.

Immunogeno

Synthetic peptide directed towards the C terminal region of human GOT2

Applicazioni

Anti-GOT2 (AB2) polyclonal antibody is used to tag mitochondrial aspartate aminotransferase protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of mitochondrial aspartate aminotransferase in energy metabolism and amino acid composition management by cells.

Azioni biochim/fisiol

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Sequenza

Synthetic peptide located within the following region: AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1