Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV45801

Sigma-Aldrich

Anti-CBR1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-CBR, Anti-Carbonyl reductase 1, Anti-hCBR1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 354.00

CHF 354.00


Spedizione prevista il30 aprile 2025



Scegli un formato

Cambia visualizzazione
100 μL
CHF 354.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 354.00


Spedizione prevista il30 aprile 2025


Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

30 kDa

Reattività contro le specie

rabbit, mouse, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CBR1(873)

Immunogeno

Synthetic peptide directed towards the C terminal region of human CBR1

Azioni biochim/fisiol

Carbonyl reductase 1 (CBR1) is a ubiquitous, cytosolic, short-chain dehydrogenase. This enzyme acts on a substantial number of biologically and pharmacologically active substrates, including a variety of endogenous and xenobiotic carbonyl compounds.

Sequenza

Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Yuta Ito et al.
Journal of nutritional science and vitaminology, 59(4), 358-364 (2013-09-26)
The mechanisms by which resveratrol (3,4',5-trihydroxy-trans-stilbene) elicits diverse health benefits remain unclear because the intracellular target molecules of resveratrol are poorly defined. We screened resveratrol-binding proteins from lysates of MCF-7 breast cancer cells using resveratrol-affinity resin, which was constructed by
Miran Jang et al.
Cancer research, 72(16), 4214-4224 (2012-06-22)
Arsenic trioxide (As2O3) is used, in current practice, as an effective chemotherapeutic agent for acute promyelocytic leukemia (APL). However, the side effects and relatively low efficacy of As2O3 in treating other leukemias have limited its wider use in therapeutic applications.

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.