AV41699
Anti-PKLR antibody produced in rabbit
IgG fraction of antiserum
Sinonimo/i:
Anti-PK1, Anti-PKL, Anti-Pyruvate kinase, liver and RBC, Anti-RPK
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
58 kDa
Reattività contro le specie
human, rat, pig, rabbit, bovine, dog, mouse
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... PKLR(5313)
Categorie correlate
Descrizione generale
Pyruvate kinase (PKLR) is a liver/erythrocyte-specific enzyme that exists as a tetramer. It comprises structural and functional domains namely N. A and C domains. The C domain is erythrocyte-specific and the A domain is active site residues. The PKLR gene is mapped to human chromosome 1q22.
Immunogeno
Synthetic peptide directed towards the N terminal region of human PKLR
Applicazioni
Anti-PKLR antibody produced in rabbit has been used in western blotting.
Azioni biochim/fisiol
Pyruvate kinase (PKLR) is needed for energy generation in erythrocytes. Deficiency of PKLR in mice reduces the risk of blood-stage malarial parasite Plasmodium chabaudi induced infection.
Sequenza
Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Rebekah van Bruggen et al.
PloS one, 10(12), e0144555-e0144555 (2015-12-15)
Pyruvate kinase (PKLR) is a critical erythrocyte enzyme that is required for glycolysis and production of ATP. We have shown that Pklr deficiency in mice reduces the severity (reduced parasitemia, increased survival) of blood stage malaria induced by infection with
Nicholas Wong et al.
International journal of cell biology, 2013, 242513-242513 (2013-03-12)
Aerobic glycolysis is the dominant metabolic pathway utilized by cancer cells, owing to its ability to divert glucose metabolites from ATP production towards the synthesis of cellular building blocks (nucleotides, amino acids, and lipids) to meet the demands of proliferation.
Daiki Nakatsu et al.
Proceedings of the National Academy of Sciences of the United States of America, 112(10), E1067-E1076 (2015-02-26)
Increase in the concentration of plasma L-cysteine is closely associated with defective insulin secretion from pancreatic β-cells, which results in type 2 diabetes (T2D). In this study, we investigated the effects of prolonged L-cysteine treatment on glucose-stimulated insulin secretion (GSIS)
Erin J Stephenson et al.
Nature communications, 13(1), 6062-6062 (2022-10-14)
Almost all effective treatments for non-alcoholic fatty liver disease (NAFLD) involve reduction of adiposity, which suggests the metabolic axis between liver and adipose tissue is essential to NAFLD development. Since excessive dietary sugar intake may be an initiating factor for
Hua-Lin Zhou et al.
Nature, 565(7737), 96-100 (2018-11-30)
Endothelial nitric oxide synthase (eNOS) is protective against kidney injury, but the molecular mechanisms of this protection are poorly understood1,2. Nitric oxide-based cellular signalling is generally mediated by protein S-nitrosylation, the oxidative modification of Cys residues to form S-nitrosothiols (SNOs).
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.