AV41562
Anti-HMGCS2 (AB1) antibody produced in rabbit
IgG fraction of antiserum, lyophilized powder
Sinonimo/i:
Anti-3-Hydroxy-3-methylglutaryl-coenzyme A synthase 2 (mitochondrial)
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
Prodotti consigliati
Origine biologica
rabbit
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
lyophilized powder
PM
56 kDa
Reattività contro le specie
canine, human, horse, rat, pig, rabbit, mouse, chicken, bovine
tecniche
western blot: suitable
Sequenza immunogenica
FSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYT
N° accesso NCBI
N° accesso UniProt
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... HMGCS2(3158)
Descrizione generale
HMG-coenzyme A synthase 2 (mitochondrial) (HMGCS2) is the mitochondrial form of HMG-CoA synthase, the enzyme that catalyzes the condensation of acetyl-CoA with acetoacetyl-CoA to form HMG-CoA. HMG-CoA synthase 2 regulates and rate-limits ketone body production and mitochondrial fatty acid oxidation within liver cells and some extrahepatic tissues such as the colon.
Specificità
Anti-HMGCS2 (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, canine, pig, and chicken HMG-coenzyme A synthase 2 proteins.
Immunogeno
synthetic peptide corresponding to a region of human HMGCS2 with an internal ID of P24247
Applicazioni
Anti-HMGCS2 (AB1) polyclonal antibody is used to tag the HMG-coenzyme A synthase 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of HMG-coenzyme A synthase 2 in ketone body production and mitochondrial fatty acid oxidation within hepatic and other tissues.
Stato fisico
Lyophilized from PBS buffer with 2% sucrose
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
11 - Combustible Solids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Maria M Mihaylova et al.
Cell stem cell, 22(5), 769-778 (2018-05-05)
Diet has a profound effect on tissue regeneration in diverse organisms, and low caloric states such as intermittent fasting have beneficial effects on organismal health and age-associated loss of tissue function. The role of adult stem and progenitor cells in
Chia-Wei Cheng et al.
Cell, 178(5), 1115-1131 (2019-08-24)
Little is known about how metabolites couple tissue-specific stem cell function with physiology. Here we show that, in the mammalian small intestine, the expression of Hmgcs2 (3-hydroxy-3-methylglutaryl-CoA synthetase 2), the gene encoding the rate-limiting enzyme in the production of ketone
Ubaldo E Martinez-Outschoorn et al.
Cell cycle (Georgetown, Tex.), 11(21), 3964-3971 (2012-10-23)
We have previously proposed that catabolic fibroblasts generate mitochondrial fuels (such as ketone bodies) to promote the anabolic growth of human cancer cells and their metastasic dissemination. We have termed this new paradigm "two-compartment tumor metabolism." Here, we further tested
Semir Beyaz et al.
Nature, 531(7592), 53-58 (2016-03-05)
Little is known about how pro-obesity diets regulate tissue stem and progenitor cell function. Here we show that high-fat diet (HFD)-induced obesity augments the numbers and function of Lgr5(+) intestinal stem cells of the mammalian intestine. Mechanistically, a HFD induces
Victoire Gouirand et al.
The EMBO journal, 41(9), e110466-e110466 (2022-03-22)
Pancreatic ductal adenocarcinoma (PDA) tumor cells are deprived of oxygen and nutrients and therefore must adapt their metabolism to ensure proliferation. In some physiological states, cells rely on ketone bodies to satisfy their metabolic needs, especially during nutrient stress. Here
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.