Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV32479

Sigma-Aldrich

Anti-NCOR1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Nuclear receptor co-repressor 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 356.00

CHF 356.00


Check Cart for Availability


Scegli un formato

Cambia visualizzazione
100 μL
CHF 356.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

CHF 356.00


Check Cart for Availability

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

270 kDa

Reattività contro le specie

mouse, dog, human, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... NCOR1(9611)

Descrizione generale

Nuclear receptor co-repressor 1/thyroid-hormone- and retinoic-acid-receptor-associated co-repressor 1 (NCOR1, TRAC-1) is a transcriptional coregulatory protein that recruits histone deacetylases to DNA promoter regions and assists nuclear receptors in the down regulation of RNA expression. NCOR1 controls thyroid hormone sensitivity and the set point of the hypothalamic-pituitary-thyroid axis. NCOR1 plays an adaptive role in muscle physiology.
Rabbit polyclonal anti-NCOR1 antibody reacts with human, canine, and mouse nuclear receptor co-repressor 1 transcriptional coregulatory proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human NCOR1

Applicazioni

Rabbit Anti-NCOR1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Rabbit polyclonal anti-NCOR1 antibody is used to tag nuclear receptor co-repressor 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of nuclear receptor co-repressor 1 in the hypothalamic-pituitary-thyroid axis regulation and muscle physiology.

Azioni biochim/fisiol

NCOR1 mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p.

Sequenza

Synthetic peptide located within the following region: NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKK

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Qingyun Peng et al.
International journal of biological sciences, 16(15), 2974-2988 (2020-10-17)
Sepsis-induced myocardial dysfunction (SIMD) is a life-threatening complication caused by inflammation, but how it is initiated is still unclear. Several studies have shown that extracellular high mobility group box 1 (HMGB1), an important cytokine triggering inflammation, is overexpressed during the

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.