Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV03005

Sigma-Aldrich

Anti-CDK6 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Cyclin-dependent kinase 6, Anti-MGC59692, Anti-PLSTIRE

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
CHF 313.00

CHF 313.00


Check Cart for Availability
Per il tuo target è disponibile un anticorpo ricombinante privo di conservanti. Prova ZRB1490


Scegli un formato

Cambia visualizzazione
100 μL
CHF 313.00

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.43

CHF 313.00


Check Cart for Availability
Per il tuo target è disponibile un anticorpo ricombinante privo di conservanti. Prova ZRB1490

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

37 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CDK6(1021)

Immunogeno

Synthetic peptide directed towards the C terminal region of human CDK6

Applicazioni

Anti-CDK6 antibody produced in rabbit is suitable for western blotting at a concentration of 0.625 μg/ml.

Azioni biochim/fisiol

CDK6 is a D-type cyclin dependent kinase that initiates the phosphorylation of Rb tumor suppressor protein. In selected cell types the cyclin D/CDK6 activity is essential for cell proliferation. In collaboration with pRb, CDK6 has been discovered to play an important role in cell differentiation and in maintaining the cell cycle exit during differentiation.

Descrizione del bersaglio

CDK6 is a cyclin-dependent kinase important in regulating cell cycle progression specifically transitioning from G1 to G1/S phase.

Sequenza

Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Martha J Grossel et al.
Cell cycle (Georgetown, Tex.), 5(3), 266-270 (2006-01-18)
Over ten years ago, cdk6 was identified as a new member in a family of vertebrate cdc-2 related kinases. This novel kinase was found to partner with the D-type cyclins and to possess pRb kinase activity in vitro. Recently, several
Naoko Ohtani et al.
The journal of medical investigation : JMI, 51(3-4), 146-153 (2004-10-06)
The p16INK4a tumor suppressor protein functions as an inhibitor of CDK4 and CDK6, the D-type cyclin-dependent kinases that initiate the phosphorylation of the retinoblastoma tumor suppressor protein, RB. Thus, p16INK4a has the capacity to arrest cells in the G1-phase of
Katarzyna Kozar et al.
Cell cycle (Georgetown, Tex.), 4(3), 388-391 (2005-03-02)
D-type cyclins (cyclin D1, D2 and D3) and their associated cyclin-dependent kinases CDK4 and CDK6 were thought to represent important, perhaps essential components of the core cell cycle apparatus. However, recent analyses of mice lacking D-cyclins, or CDK4 and CDK6

Questions

Reviews

No rating value

Active Filters

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.