WH0083881M2

Monoclonal Anti-MIXL1 antibody produced in mouse

clone 4D11, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-MGC138179, Anti-MILD1, Anti-MIXL, Anti-Mix1 homeobox-like 1 (Xenopus laevis)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4D11, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgGκ
• Numéro d'accès GenBank: NM_031944
• Numéro d'accès UniProt: Q9H2W2
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Informations sur le gène: human ... MIXL1(83881)

Description

Description générale

Mix paired-like homeobox, also known as mesoderm inducer in Xenopus like 1 (MIXL1), is a homeobox transcription factor. It is induced by the transforming growth factor-β family of ligands. MIXL1 is expressed in hematopoietic stem cells and progenitor cells. The gene encoding it is localized on human chromosome 1q42.12.[1][2]

Immunogène

MIXL1 (NP_114150, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLP

Actions biochimiques/physiologiques

Mesoderm inducer in Xenopus like 1 (MIXL1) is crucial for specification of the mesoderm and endoderm during early embryogenesis. It modulates the proto-oncogene c-REL. The protein may have a role in acute myelogenous leukemia.[2]

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): nwg
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)