Accéder au contenu
Merck
Toutes les photos(7)

Principaux documents

WH0064399M1

Sigma-Aldrich

Monoclonal Anti-HHIP antibody produced in mouse

clone 5D11, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-FLJ20992, Anti-FLJ90230, Anti-HIP, Anti-hedgehog interacting protein

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
473.00 CHF

473.00 CHF

Check Cart for Availability
Toutes les photos(7)

Sélectionner une taille de conditionnement

Changer de vue
100 μG
473.00 CHF

About This Item

Numéro MDL:
MFCD01094561
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

473.00 CHF

Check Cart for Availability

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

5D11, monoclonal

Forme

buffered aqueous solution

Espèces réactives

rat, human, mouse

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2bκ

Numéro d'accès GenBank

NM_022475

Numéro d'accès UniProt

Q96QV1

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HHIP(64399)

Catégories apparentées

Description générale

This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. (provided by RefSeq)

Immunogène

HHIP (NP_071920, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ

Application

Monoclonal Anti-HHIP antibody produced in mouse has been used in immnohistochemistry.

Actions biochimiques/physiologiques

The gene encoding HHIP (hedgehog interacting protein) is located on human chromosome 4, and encodes for a protein belonging to the hedgehog-interacting protein (HHIP) family. Hedgehog (HH) proteins are evolutionarily conserved proteins, and are important morphogens for a vast range of developmental processes, like regulation of left-right asymmetry and anteroposterior patterns of limbs during embryonic development. HH signals are regulated by numerous cell-surface receptors. HHIP encoded by this gene is highly conserved and interacts with all the three HH family members namely SHH (sonic hh), IHH (indian hh) and DHH (desert hh). It is also a vertebrate-specific inhibitor of HH signaling. Single nucleotide polymorphisms (SNPs) in HHIP gene is associated with increase in the risk of chronic obstructive pulmonary disease (COPD).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
F7301-5D11
D3151-5D11
08333-5D11
08256-5D11
06146-5D11

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Association of HHIP polymorphisms with COPD and COPD-related phenotypes in a Chinese Han population.
Wang B
Gene (2013)
Epigenetic regulation of human hedgehog interacting protein in glioma cell lines and primary tumor samples.
Shahi MH
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine (2015)
Shh-mediated degradation of Hhip allows cell autonomous and non-cell autonomous Shh signalling.
Kwong L
Nature Communications (2014)
Hhip haploinsufficiency sensitizes mice to age-related emphysema
Taotao Lao
Proceedings of the National Academy of Sciences of the USA (2016)
Gene expression analysis uncovers novel hedgehog interacting protein (HHIP) effects in human bronchial epithelial cells.
Zhou X
Genomics (2013)
Afficher tous les articles scientifiques apparentés

Questions

  1. Could you please provide information on the protocol used for the validation of the HHIP antibody WH0064399M1 in chromogenic IHC on FFPE? I am particularly interested in the dilution, secondaries, and control tissue information.

    1 answer

    1. The antibody was successfully validated for formalin-fixed paraffin-embedded human heart tissue using the following protocol:

      1. Deparaffinize the paraffin-embedded sections by heating at 57°C for 60 minutes and rehydrate for 3 minutes in the following solutions: 2x xylene, 1x xylene:100% ethanol, 2x 100% ethanol, 1x 95% ethanol, 70% ethanol, 50% ethanol, and cold tap water.

      2. Perform heat-induced epitope retrieval in 1 X citrate buffer (pH 6.0) and microwave at 750 W for 20 minutes.

      3. Quench endogenous peroxidase activity with 0.1% H2O2 for 20 minutes.

      4. Permeabilize with 0.05% saponin diluted in PBS for 5 minutes.

      5. Use the Vectastain Elite ABC Universal Kit for immunohistochemical detection per the manufacturer's instructions.

      6. Incubate sections with primary antibody anti-HHIP clone M01 WH0064399M1-100UG (1:100) at 4°C overnight. Omit primary antibodies for negative controls.

      7. Visualize immunoreactivity with 3,3'-diaminobenzidine (DAB) substrate.

      8. Counterstain cells for 30 seconds with hematoxylin and mount with Mowiol.

      9. Examine staining under an inverted light microscope and digitally record at 40x magnification.

      Helpful?

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique