Accéder au contenu
Merck
Toutes les photos(5)

Principaux documents

WH0064093M3

Sigma-Aldrich

Monoclonal Anti-SMOC1 antibody produced in mouse

clone 8F10, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-SPARC related modular calcium binding 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
502.00 CHF

502.00 CHF


Date d'expédition estimée le30 avril 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μG
502.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

502.00 CHF


Date d'expédition estimée le30 avril 2025


Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

8F10, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SMOC1(64093)

Description générale

SPARC related modular calcium binding 1 (SMOC1) is an extracellular glycoprotein belonging to the SPARC family. It is localized and secreted in bone marrow derived mesenchymal stem cells (BMSCs) stimulated with osteogenic medium (OSM). The protein is expressed in the developing optic stalk, ventral optic cup, and limbs of mouse embryos. It is composed of five domains, an N-terminal follistatin-like (FS) domain, two thyroglobulin-like (TY) domains similar to SMOC, and an extracellular calcium-binding (EC) domain.

Immunogène

SMOC1 (NP_071420, 150 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNS

Actions biochimiques/physiologiques

SMOC1 plays an essential role in ocular and limb development. It participates in the regulation of cell-matrix interaction by binding to many cell-surface receptors, the extracellular matrix, growth factors, and cytokines. It also functions in bone morphogenetic proteins (BMP) signaling cascade. Mutation in SMOC1 causes a rare autosomal-recessive disorder, microphthalmia and limb anomalies (MLA).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Hana Abouzeid et al.
American journal of human genetics, 88(1), 92-98 (2011-01-05)
Waardenburg anophthalmia syndrome, also known as microphthalmia with limb anomalies, ophthalmoacromelic syndrome, and anophthalmia-syndactyly, is a rare autosomal-recessive developmental disorder that has been mapped to 10p11.23. Here we show that this disease is heterogeneous by reporting on a consanguineous family, not
Young-Ae Choi et al.
Journal of proteome research, 9(6), 2946-2956 (2010-04-03)
Extracellular matrix proteins have been implicated in the regulation of osteoblast differentiation of bone marrow derived mesenchymal stem cells (BMSCs) through paracrine or autocrine mechanisms. In the current study, we analyzed the secretory protein profiles of BMSCs grown in osteogenic
Ippei Okada et al.
American journal of human genetics, 88(1), 30-41 (2011-01-05)
Microphthalmia with limb anomalies (MLA) is a rare autosomal-recessive disorder, presenting with anophthalmia or microphthalmia and hand and/or foot malformation. We mapped the MLA locus to 14q24 and successfully identified three homozygous (one nonsense and two splice site) mutations in

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique