Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

WH0009507M1

Sigma-Aldrich

Monoclonal Anti-ADAMTS4 antibody produced in mouse

clone 2A6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-ADAM metallopeptidase with thrombospondin type 1 motif, 4, Anti-ADAMTS2, Anti-ADAMTS4, Anti-ADMP1, Anti-KIAA0688

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
474.00 CHF

474.00 CHF


Date d'expédition estimée le01 mai 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μG
474.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

474.00 CHF


Date d'expédition estimée le01 mai 2025


Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2A6, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ADAMTS4(9507)

Description générale

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma. (provided by RefSeq)

Immunogène

ADAMTS4 (AAH63293, 693 a.a. ~ 802 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RKFRYGYNNVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFV

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique