Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

WH0004288M1

Sigma-Aldrich

Monoclonal Anti-MKI67 antibody produced in mouse

clone 7B8, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-KIA, Anti-Ki67

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
473.00 CHF

473.00 CHF


Check Cart for Availability
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1007


Sélectionner une taille de conditionnement

Changer de vue
100 μG
473.00 CHF

About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

473.00 CHF


Check Cart for Availability
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1007

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

7B8, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MKI67(4288)

Catégories apparentées

Description générale

Ki-67 (antigen KI-67) has a gene size of 29,545 bp and it consists of 15 exons and 14 introns. It has a minus strand orientation. This gene is located on human chromosome 10q26.2.
This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. (provided by RefSeq)

Immunogène

MKI67 (NP_002408, 3157 a.a. ~ 3256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Application

Monoclonal Anti-MKI67 antibody has been used in immunohistochemistry (IHC).

Actions biochimiques/physiologiques

Ki-67 (antigen KI-67) protein acts as a cellular marker for proliferation. This protein plays a major role in the maintenance and regulation of the cell division cycle. Ki-67, a part of the mitotic chromosome periphery, function as a biological surfactant to maintain individual mitotic chromosomes dispersed in the cytoplasm after nuclear envelope disassembly.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Les clients ont également consulté

Expression of FOXC2, PinX1, Ki-67 and Cyclin D1 in cutaneous cell carcinoma
Zhao H, et al.
Oncology Letters, 14(1), 635-638 (2017)
Prognostic impact of Ki-67 in patients with gastric cancer-the importance of depth of invasion and histologic differentiation
Ko GH, et al.
Medicine, 96(25) (2017)
Ki-67 acts as a biological surfactant to disperse mitotic chromosomes.
Cuylen S, et al.
Nature, 535(7611), 308-308 (2016)
C Schlüter et al.
The Journal of cell biology, 123(3), 513-522 (1993-11-01)
The antigen defined by mAb Ki-67 is a human nuclear protein the expression of which is strictly associated with cell proliferation and which is widely used in routine pathology as a "proliferation marker" to measure the growth fraction of cells
Haiying Zhao et al.
Oncology letters, 14(1), 635-638 (2017-07-12)
We investigated the expression of FOXC2, PinX1, Ki-67 and Cyclin D1 in cutaneous cell carcinoma. We collected 30 cutaneous squamous cell carcinoma (SCC), 30 cutaneous basal cell carcinoma (BCC) and 30 normal skin tissues. The protein expression and gene expression

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique