Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

WH0003043M1

Sigma-Aldrich

Monoclonal Anti-HBB antibody produced in mouse

clone 2H3, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-CD113tC, Anti-HBD, Anti-hemoglobin, Anti-hemoglobin, beta

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
473.00 CHF

473.00 CHF


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μG
473.00 CHF

About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

473.00 CHF


Check Cart for Availability

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2H3, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

ELISA: suitable
capture ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG3κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... HBB(3043)

Description générale

HBB (hemoglobin subunit β) codes for a β-globin that consists of three exons. This gene is located on human chromosome 11p15. HBB is a serum protein that belongs to the histone-like protein family.
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5′-epsilon -- gamma-G -- gamma-A -- delta -- beta--3′. (provided by RefSeq)

Immunogène

HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH

Actions biochimiques/physiologiques

HBB (hemoglobin subunit β) participates in oxygen transport from the lung to various peripheral tissues. Mutation in HBB result in Sickle cell disease (SCD). Overexpression of HBB has been observed in patients with periodontal disease.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Proteomic analysis of saliva identifies potential biomarkers for orthodontic tooth movement
Ellias MF, et al.
TheScientificWorldJournal (2012)
Two novel C-terminal frameshift mutations in the ?-globin gene lead to rapid mRNA decay
Rawa K, et al.
BMC Medical Genetics, 18(1), 65-65 (2017)
Loss of heterozygosity for chromosome 11 in primary human breast tumors is associated with poor survival after metastasis
Winqvist R, et al.
Cancer Research, 55(12), 2660-2664 (1995)
A phylogenetic analysis of Borrelia burgdorferi sensu lato based on sequence information from the hbb gene, coding for a histone-like protein
Valsangiacomo C, et al.
International Journal of Systematic Bacteriology, 47(1), 1-10 (1997)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique