Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

SAB2109093

Sigma-Aldrich

Anti-Sgms1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

9530058O11Rik, AI841905, C80702, MGC30540, Mob

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
380.00 CHF

380.00 CHF


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μL
380.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

380.00 CHF


Check Cart for Availability

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

46 kDa

Réactivité de l'espèce (prédite par homologie)

canine, mouse, bovine, rabbit, human, guinea pig, rat, horse

Concentration

0.5 mg/mL

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SGMS1(259230)

Description générale

Bidirectional lipid cholinephosphotransferase is capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. Sgms1 directly and specifically recognizes the choline head group on the substrate. It also requires two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. Sgms1 does not function strictly as a SM synthase and suppresses BAX-mediated apoptosis and also prevents cell death in response to stimuli such as hydrogen peroxide, osmotic stress, elevated temperature and exogenously supplied sphingolipids. Sgms1 may protect against cell death by reversing the stress-inducible increase in levels of proapoptotic ceramide.

Immunogène

Synthetic peptide directed towards the middle region of Mouse Sgms1

Séquence

Synthetic peptide located within the following region: LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL

Forme physique

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

Si vous avez besoin d'assistance, veuillez contacter Service Clients

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique