Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

SAB2108630

Sigma-Aldrich

Anti-KLB

affinity isolated antibody

Synonyme(s) :

Anti- MGC142213, Anti-BKL

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
502.00 CHF

502.00 CHF


Date d'expédition estimée le16 avril 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μL
502.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

502.00 CHF


Date d'expédition estimée le16 avril 2025


Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

120 kDa

Espèces réactives

rat, mouse, human, bovine

Concentration

0.5-1 mg/mL

Technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

Numéro d'accès

NM_175737

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... KLB(152831)

Immunogène

Synthetic peptide directed towards the middle region of human KLB

Actions biochimiques/physiologiques

KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.

Séquence

Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Gexiang Cai et al.
Experimental biology and medicine (Maywood, N.J.), 244(3), 252-261 (2019-02-05)
In this study, we reported for the first time that FGF21 alleviated hypoxia-induced pulmonary hypertension through attenuation of increased pulmonary arterial pressure, pulmonary arterial remodeling and collagen deposition in vivo, and we confirmed the mutual promotion of FGF21 and PPARγ
Yan Sun et al.
Theranostics, 10(18), 8430-8445 (2020-07-30)
A viewpoint considering Alzheimer's disease (AD) as "type 3 diabetes" emphasizes the pivotal role of dysfunctional brain energy metabolism in AD. The hormone fibroblast growth factor 21 (FGF21) is a crucial regulator in energy metabolism; however, our understanding of the

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique