Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB2107648

Sigma-Aldrich

Anti-DNASE1L3 antibody produced in rabbit

affinity isolated antibody

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

34 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DNASE1L3(1776)

Catégories apparentées

Description générale

DNASE1L3 (Deoxyribonuclease I-like 3) is a 32kDa endonuclease protein expressed in the spleen, liver, thymus, lymph node, bone marrow, small intestine and kidney. It consists of an N-terminal signal peptide responsible for the rER (rough endoplasmic reticulum) transport.

Immunogène

The immunogen for anti-DNASE1L3 antibody: synthetic peptide derected towards the C terminal of human DNASE1L3

Application

Anti-DNASE1L3 antibody produced in rabbit is suitable for western blot and indirect ELISA.

Actions biochimiques/physiologiques

DNASE1L3 (Deoxyribonuclease I-like 3) is involved in residual nuclease activity of internucleosomal chromatin. In presence of Ca2+/Mg2+, it produces 3′-OH/5′-P ends by cleaving both the DNA strand, double-stranded and single-stranded DNA molecule. It has also been reported that DNASE1L3 may cleave apoptotic DNA of thymocytes, neuronal PC12 cells, C2C12 myoblasts and of cell lines expressing the recombinant nuclease. Mutation in DNASE1L3 causes a rare syndrome, hypocomplementemic urticarial vasculitis syndrome (HUVS).

Séquence

Synthetic peptide located within the following region: DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Z Birsin Ozçakar et al.
Arthritis and rheumatism, 65(8), 2183-2189 (2013-05-15)
Hypocomplementemic urticarial vasculitis syndrome (HUVS) is characterized by recurrent urticaria along with dermal vasculitis, arthritis, and glomerulonephritis. Systemic lupus erythematosus (SLE) develops in >50% of patients with HUVS, although the pathogenesis is unknown. The aim of this study was to
Markus Napirei et al.
The Biochemical journal, 389(Pt 2), 355-364 (2005-03-31)
Deoxyribonuclease 1 (DNASE1, DNase I) and deoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) are members of a DNASE1 protein family that is defined by similar biochemical properties such as Ca2+/Mg2+-dependency and an optimal pH of about 7.0 as

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique