Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

SAB1402301

Sigma-Aldrich

Monoclonal Anti-PCP4 antibody produced in mouse

clone 1E3, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

PEP-19

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
403.00 CHF

403.00 CHF


Check Cart for Availability
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1732


Sélectionner une taille de conditionnement

Changer de vue
100 μG
403.00 CHF

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

403.00 CHF


Check Cart for Availability
Un anticorps recombinant, sans conservateur, est disponible pour votre cible. Essayez ZRB1732

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1E3, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~32.93 kDa

Espèces réactives

human

Technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PCP4(5121)

Description générale

Purkinje cell protein 4 (PCP4) is an anti-apoptotic, calmodulin-binding peptide which is expressed in neural cells. It is also expressed in the Purkinje cells of the cerebellum, kidneys, prostate and the uterus. PCP4 is a 7.6kDa with an IQ-motif. The gene encoding this protein is localized on human chromosome 21q22.2.

Immunogène

PCP4 (NP_006189.2, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

Actions biochimiques/physiologiques

Purkinje cell protein 4 (PCP4) may have a role in apoptosis and cellular degeneration. It acts as an accelerator of calcium association and disassociation with calmodulin. The protein also functions in synaptic plasticity.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

PCP4 maps between D21S345 and P31P10SP6 on chromosome 21q22.2-->q22.3.
Hubert RS and Korenberg JR
Cytogenetics and Cell Genetics (1997)
PCP4: a regulator of aldosterone synthesis in human adrenocortical tissues.
Journal of Molecular Endocrinology (2014)
Anti-apoptotic effects of PCP4/PEP19 in human breast cancer cell lines: a novel oncotarget.
Hamada T
Oncotarget (2014)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique