Accéder au contenu
Merck
Toutes les photos(1)

Principaux documents

MSST0064

Sigma-Aldrich

SILuProt Insulin, human

recombinant, expressed in Pichia pastoris, SIL MS Protein Standard, 15N -labeled

Synonyme(s) :

in situ Proximity Ligation Assay reagent, Insulin

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

10 μG
865.00 CHF

865.00 CHF


Check Cart for Availability

Devis pour commande en gros

Sélectionner une taille de conditionnement

Changer de vue
10 μG
865.00 CHF

About This Item

Code UNSPSC :
23201100
Nomenclature NACRES :
NA.32

865.00 CHF


Check Cart for Availability

Devis pour commande en gros

Produit recombinant

expressed in Pichia pastoris

Niveau de qualité

Essai

≥95% (HPLC)

Forme

dry pellets

Puissance

≥97% (Heavy amino acids incorporation efficiency by MS)

Adéquation

suitable for mass spectrometry (standard)

Conditions d'expédition

ambient

Température de stockage

−20°C

Informations sur le gène

human ... INS(3630)

Catégories apparentées

Description générale

SILu Prot Insulin is a recombinant, stable 15N isotope-labeled human Insulin Expressed in P. pastoris, it is designed to be used as an internal standard for bioanalysis of Insulin in mass-spectrometry. SILu Prot Insulin is a disulfate bonded hetero-dimer protein composed of two chains. Chain A of 21 amino acids and a thoretical amolecular mass of 2408.5; Chain B of 30 amino acids and a thoretical amolecular mass of 3468.7 (Note that Thr30 in chain B is not 15N labeled).

Actions biochimiques/physiologiques

Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat.

Séquence

A chain: GIVEQCCTSICSLYQLENYCN
B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Forme physique

Supplied as dried pellet from a solution containing 1% acetic acid.

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Les clients ont également consulté

Slide 1 of 1

1 of 1

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique