Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

HPA037837

Sigma-Aldrich

Anti-IPMK antibody produced in rabbit

enhanced validation

affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Inositol polyphosphate multikinase

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
556.00 CHF

556.00 CHF


Date d'expédition estimée le02 juin 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μL
556.00 CHF

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

556.00 CHF


Date d'expédition estimée le02 juin 2025


Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
Learn more about Antibody Enhanced Validation

Technique(s)

immunofluorescence: 0.25-2 μg/mL

Séquence immunogène

DCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSD

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IPMK(253430)

Catégories apparentées

Description générale

The gene encoding inositol polyphosphate multikinase (IPMK) enzyme is located on human chromosome 10q21.1. IPMK consists of inositol phosphate binding, nuclear localization signal, and ATP-binding kinase domain. It is a catalytically flexible enzyme and is part of intracellular signalling network.

Immunogène

inositol polyphosphate multikinase recombinant protein epitope signature tag (PrEST)

Application

Anti-IPMK antibody produced in rabbit may be used for the detection of IPMK protein in
  • lymphoblasts by immunoprecipitation
  • human adenocarcinogenic cell lines by western blotting
  • in mouse 3T3 cells by western blotting

Actions biochimiques/physiologiques

Inositol polyphosphate multikinase (IPMK) indirectly mediates mRNA transport from nucleus to cytoplasm by mediating synthesis of phosphatidylinositol levels. IPMK interacts and stabilizes tumor necrosis factor receptor in HEK293T cells.IPMK coordinates with various signaling networks. Its deletion impairs immune response signalling pathways. Knockdown of IPMK leads to imbalance in the inositol polyphosphates. IPMK binds to tumor suppressor protein and regulates transcription and cell death. Mutation in the IPMK gene results in a truncated protein with reduced kinase activity. IPMK gene deletion or RNA interference results in cell growth inhibition. IPMK is regarded as prime target for tumor suppression. Pathology of Huntington′s disease is associated with IPMK protein depletion. In Alzheimer′s patients, low IPMK transcript levels may play a key in neurodegeneration.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST80294

Forme physique

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

The human homolog of the rat inositol phosphate multikinase is an inositol 1, 3, 4, 6-tetrakisphosphate 5-kinase
Chang , et al.
The Journal of Biological Chemistry, 277(46), 43836-43843 (2002)
Oisun Jung et al.
The EMBO journal, 43(9), 1740-1769 (2024-04-03)
The Hippo pathway effectors Yes-associated protein 1 (YAP) and its homolog TAZ are transcriptional coactivators that control gene expression by binding to TEA domain (TEAD) family transcription factors. The YAP/TAZ-TEAD complex is a key regulator of cancer-specific transcriptional programs, which
The Regulation of Runx2 by FGF2 and Connexin43 Requires the Inositol Polyphosphate/Protein Kinase Cdelta Cascade
Niger C, et al.
Journal of Bone and Mineral Research, 28(6), 1468-1468 (2013)
Radiosensitization of tumour cell lines by the polyphenol Gossypol results from depressed double-strand break repair and not from enhanced apoptosis
Kasten-Pisula U, et al.
Radiotherapy and Oncology : Journal of the European Society for Therapeutic Radiology and Oncology, 83(3), 296-303 (2007)
The human homologue of yeast ArgRIII protein is an inositol phosphate multikinase with predominantly nuclear localization
Nalaskowski MM, et al.
The Biochemical Journal, 366(2), 549-556 (2002)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique