HPA025073

Anti-SPRTN antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-C1orf124, Anti-Zinc finger RAD18 domain-containing protein C1orf124
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA025073
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Technique(s): immunofluorescence: 0.25-2 μg/mL
• Séquence immunogène: SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDT
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... C1orf124(83932)

Description

Description générale

C1orf124/Spartan, a protein that contains a PCNA-interacting peptide motif, called a PIP box, and a UBZ4 ubiquitin-binding domain, is involved in Rad18-mediated Proliferating Cell Nuclear Antigen (PCNA) ubiquitination and the regulation of DNA damage tolerance via post-replication repair (PRR). It promotes a feed-forward loop to enhance PCNA ubiquitylation and translesion DNA synthesis. Spartan plays an important role in preventing mutations associated with replication of damaged DNA.

Rabbit polyclonal Anti-C1orf124 antibody reacts with human zinc finger RAD18 domain-containing protein C1orf124/spartan.

Immunogène

Zinc finger RAD18 domain-containing protein C1orf124 recombinant protein epitope signature tag (PrEST)

Application

Rabbit polyclonal Anti-C1orf124 antibody is used to tag zinc finger RAD18 domain-containing protein/Spartan for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques such as ELISA, immunoblotting, and immunoprecipitation. It is used as a probe to determine the presence and roles of zinc finger RAD18 domain-containing protein/Spartan in the regulation of DNA damage tolerance via post-replication repair (PRR).

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST76479

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable