Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

HPA005131

Sigma-Aldrich

Anti-REN antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Angiotensinogenase antibody produced in rabbit, Anti-Renin precursor antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
481.00 CHF

481.00 CHF


Date d'expédition estimée le28 mai 2025



Sélectionner une taille de conditionnement

Changer de vue
100 μL
481.00 CHF

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

481.00 CHF


Date d'expédition estimée le28 mai 2025


Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:50- 1:200

Séquence immunogène

FHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... REN(5972)

Catégories apparentées

Description générale

REN gene encodes the enzyme renin, which is expressed mainly by the granular cells of the kidney in the juxtaglomerular apparatus. REN gene is 12.5kb in length and is localised to the chromosomal region 1q32. Renin is a protease enzyme, which cleaves at the aspartate residue and is synthesised as prorenin. Prorenin includes an additional 43 amino acid fragment at the N-terminal. Renin has a molecular weight of 37kDa and is composed of 340 amino acids. There is evidence that renin is also expressed in ovary, testis, submandibular gland, adrenal gland, brain, heart etc.

Immunogène

Renin precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

Renin is a key enzyme in the renin-angiotensin system (RAS), which is responsible for maintaining blood pressure and salt homeostasis. Renin converts the inactive angiotensinogen to angiotensin I and this step is the rate limiting step in RAS. Angiotensin I is then converted into angiotensin II, which, through a series of steps, leads to an increase in blood pressure and sodium retention by kidneys. Mutations, which lead to the deletion of leucine or exchange of leucine in the signal peptide of prorenin, are found to be associated with early onset anemia, hypouricosuric hyperuricemia and progressive kidney failure. Renin rs6693954 polymorphism has been linked with blood pressure in type II diabetes patients, in a gender-dependent manner.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST85921

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Min-Hua Tseng et al.
Cells, 10(4) (2021-05-01)
We has identified a founder homozygous E3_E4 del: 2870 bp deletion + 9 bp insertion in AGT gene encoding angiotensinogen responsible for autosomal recessive renal tubular dysgenesis (ARRTD) with nearly-fatal outcome. High-dose hydrocortisone therapy successfully rescued one patient with an
U Mohana Vamsi et al.
Journal of the renin-angiotensin-aldosterone system : JRAAS, 14(3), 242-247 (2012-10-31)
Renin is a rate-limiting enzyme of the renin-angiotensin-aldosterone system (RAAS) that plays a crucial role in the regulation of blood pressure. The renin gene has been suggested as a marker for genetic predisposition to essential hypertension (EHT) in humans. The
Genevieve Nguyen et al.
The Journal of clinical investigation, 109(11), 1417-1427 (2002-06-05)
Renin is an aspartyl protease essential for the control of blood pressure and was long suspected to have cellular receptors. We report the expression cloning of the human renin receptor complementary DNA encoding a 350-amino acid protein with a single
Liza U Ljungberg et al.
Journal of the renin-angiotensin-aldosterone system : JRAAS, 15(1), 61-68 (2013-01-30)
Patients with type 2 diabetes (T2D) are at high risk of developing hypertension and related cardiovascular disease. The renin-angiotensin system (RAS) plays a central role in regulation of blood pressure (BP). Accordingly, each component of this system represents a potential
Masayoshi Kukida et al.
Arteriosclerosis, thrombosis, and vascular biology, 41(11), 2851-2853 (2021-09-10)
[Figure: see text].

Questions

  1. Quelle est la concentration en µg/ml de l'anticorps svp? Merci d'avance pour votre réponse.

    1 answer
    1. The concentration will be listed on the lot-specific Certificate of Analysis. Please see the link below to the sample Certificate of Analysis:
      https://www.sigmaaldrich.com/coa/SIGMA/HPA005131/A47461

      Helpful?

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique