Accéder au contenu
Merck
Toutes les photos(3)

Principaux documents

HPA002380

Sigma-Aldrich

Anti-ABCC1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonyme(s) :

Anti-ATP-binding cassette sub-family C member 1, Anti-LTC4 transporter, Anti-Leukotriene C(4, Anti-Multidrug resistance-associated protein 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
481.00 CHF

481.00 CHF


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μL
481.00 CHF

About This Item

Numéro MDL:
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.43

481.00 CHF


Check Cart for Availability

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Séquence immunogène

LVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWD

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ABCC1(4363)

Description générale

ABCC1 (ATP binding cassette subfamily C member 1) is the members of the ATP-binding cassette (ABC) transporter superfamily. It is expressed in both endothelial cells and non-endothelia cells. Non-endothelial cells include pericytes, astrocytes, choroid plexus epithelia, ventricle ependymal cells, and neurons and larger blood vessels (mostly venules), microvasculature endothelial cells. Similar to other ABC transporters, ABCC1 also possess an additional membrane-spanning domain (MSD) with a putative extracellular, U-shaped amino terminus region.

Immunogène

Multidrug resistance-associated protein 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-ABCC1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Actions biochimiques/physiologiques

The amino terminus end of ABCC1 (ATP binding cassette subfamily C member 1) serve as a regulating gate for the drug transport activity. Its activity is dependent on the ATP binding and hydrolysis. It plays a pivotal role in drug binding as well as drug and organic anion efflux across the plasma membrane. It mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-β-glucuronide, methotrexate, antiviral drugs and other xenobiotics. It may play an important role in adenosinergic/purinergic neuromodulation. It has a significant role in the regulation of dendritic cells (DCs) migration from peripheral tissues to lymph nodes by utilizing the leukotriene C(4) (LTC(4)) transporter. ABCC1 is associated with different neurodegenerative diseases (NDs), such as Alzheimer′s and Parkinson′s.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86067

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Mark Barok et al.
Cancer letters, 473, 156-163 (2020-01-07)
The majority of HER2-positive breast or gastric cancers treated with T-DM1 eventually show resistance to this agent. We compared the effects of T-DM1 and ARX788, a novel anti-HER2 antibody-drug conjugate, on cell growth and apoptosis in HER2-positive breast cancer and
Gwenaëlle Conseil et al.
The Journal of biological chemistry, 281(1), 43-50 (2005-10-19)
The multidrug resistance protein 1 (MRP1) mediates drug and organic anion efflux across the plasma membrane. The 17 transmembrane (TM) helices of MRP1 are linked by extracellular and cytoplasmic (CL) loops of various lengths and two cytoplasmic nucleotide binding domains.
Qun Chen et al.
The Journal of biological chemistry, 281(41), 31152-31163 (2006-08-18)
Multidrug resistance is a serious problem in successful cancer chemotherapy. Studies using model cell lines have demonstrated that overexpression of some members of the ATP-binding cassette (ABC) transporter superfamily, such as ABCC1, causes enhanced efflux and, thus, decreased accumulation of
Hans-Gert Bernstein et al.
Mechanisms of ageing and development, 141-142, 12-21 (2014-09-15)
ATP-binding cassette (ABC) transporters play an increasing role in the understanding of pathologic peptide deposition in neurodegenerative diseases (NDs), such as Alzheimer's and Parkinson's. To describe the location of the most important ABC transporters for NDs in human brain tissue
Susanna J E Veringa et al.
PloS one, 8(4), e61512-e61512 (2013-05-03)
Pediatric high-grade gliomas (pHGG), including diffuse intrinsic pontine gliomas (DIPG), are the leading cause of cancer-related death in children. While it is clear that surgery (if possible), and radiotherapy are beneficial for treatment, the role of chemotherapy for these tumors

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique